DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10514 and CG33510

DIOPT Version :8

Sequence 1:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster

Alignment Length:411 Identity:102/412 (25%)
Similarity:157/412 (38%) Gaps:109/412 (26%)


  Fly    41 ENYGGVLTRA-RVE-FTLS--NK-------EKNVQ------NLIVKTE----------------I 72
            |.|..|.||. |.| |||.  ||       :||.|      |::..||                :
  Fly     4 EPYSPVFTRENRTELFTLEECNKILANLLADKNEQGVLLNFNIVPATEHTGFLGEYFHLYFQYQL 68

  Fly    73 DD--DELTQELMAPYDIY-NREMTIYQEVLP------KCRELLNEIGD-TERIFPTAIYVDRERM 127
            :|  |..|..|.....|: |..|..|.|.:.      |..:||||:.. ::.::....|..|:.:
  Fly    69 EDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYDLLNELKKFSKHVWSAKCYFTRKDL 133

  Fly   128 AIIFEDLSVVGYV-MADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTN 191
             .:.:::..:||| :....|.|||.....||:.||..||::....::|                 
  Fly   134 -FVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEKQQ----------------- 180

  Fly   192 AYSGYFVGGLLAAARWMSKV---PTLAHYGEKL------FALAPHYMD-------IGRE------ 234
               |..:|  :...:|:.:|   |.:..|...|      .|:.|..:|       |.:|      
  Fly   181 ---GKTIG--VEFRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPRCLD 240

  Fly   235 ---CFA-PTPGQVNVLAHGDVWTNNVMF-KYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTS 294
               |.. |:|...||..|.|.|..||.: |..|:..|.:   |:|||...:..|.:|.|.:...:
  Fly   241 KVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHEERSI---LVDFQLCRYSPPAMDFHLVTYLN 302

  Fly   295 LKEPLRRDQQNG-LFQFYHKIFTETLEKL--NYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPV 356
            | ||..|.:..| |.:.|:....|...::  |..|.|: |..:|:..:.....|......:...|
  Fly   303 L-EPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQL-SKQEFEQSLNDFSLFGATYNCIAATV 365

  Fly   357 MISQDPTDACFNALMN-DDER 376
            :...|      |.|.| .|||
  Fly   366 LRLPD------NYLKNLKDER 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 89/357 (25%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 54/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61732
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.