DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and CG10562

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster

Alignment Length:426 Identity:113/427 (26%)
Similarity:205/427 (48%) Gaps:48/427 (11%)


  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77
            |.|:|:|..:|.|:... |...|:.........|.|.||.::|.|:.:|...:..|.| |.:::|
  Fly     7 PDWVTAEIFEDLLKANV-DGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSK-SVSYMV 69

  Fly    78 KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVD---RERDSI 139
            |... ..:...:::....::..|..:|..::|:|..:.:....|   :.....|.|   .:.|.:
  Fly    70 KLPH-QVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVD---ITFGAKNYDLKNAKTDYV 130

  Fly   140 IFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSV-LAERQPGIFDKNYDRGFFNKHTRA 203
            ..||:.|..:|.|.|.:.||.|||..||.||:.:||||:| :|.:.|  :.|...:|||.:.:| 
  Fly   131 ALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGP--YPKILLQGFFKEESR- 192

  Fly   204 YAPIMTNLLEALSRSLASDEELGQRYKAKIDRL-------VERLMDYGERSTTSSPGDFLTLAHG 261
              |:|:.:::.:..:........:.::|.:|::       ::::.::.:    ..|.:|..|.||
  Fly   193 --PVMSEMIKGMGANFVKSCATYEGHEAYLDKVKALQPVAIDKIFEFAK----VEPTEFNVLNHG 251

  Fly   262 DLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFF--STSLQDNL-RLEHQTELVQFYY 323
            |.|:.|.||||||.........:|:|...:.:.|.||.||.  ||.|:|.| :.::   .::.|:
  Fly   252 DSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAKFDY---YIKIYH 313

  Fly   324 YRLTEALRKLKYAGRIPSLFDFQLQFRSRGFY------AVFCSLIFEPVMQYEGKEDASIEQVLS 382
            ..|.|.|:.|||:..||||.|..|.....|::      .|..:::.:|.      :.||:|..:.
  Fly   314 DNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPT------DSASLENFIG 372

  Fly   383 SSESGMRFKNSVYESENIKKKLSVTLPFLDQFGLLD 418
            .|:    |:..:|.|...:|.:...:|:|...|.|:
  Fly   373 GSD----FQMQLYNSPRYRKHIQAVMPWLLNRGALE 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 82/302 (27%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 82/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55986
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.