DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and CG10560

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster

Alignment Length:414 Identity:118/415 (28%)
Similarity:194/415 (47%) Gaps:21/415 (5%)


  Fly    11 PAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTF 75
            |.|.|:..|..:|.|:...||.. |...|..|..||.|.||.::|.|:.::..|| .|.:.:..|
  Fly    16 PIPGWVKPEVFEDLLKDNVKDYK-KTKALRAKAGVAAGENYATIMLRLELDVETK-DKSEVTKAF 78

  Fly    76 LVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRERDSII 140
            ::||.. |.|....:|....::..|..:|..::|:|..|.| ::....|..|....:....:.::
  Fly    79 MLKTPH-DTDAYRKLLQETNIFDVERGMYLVVVPELEQMYR-DVGLEVKFGAEAYEIKVSENYVL 141

  Fly   141 FEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFF------NK 199
            .||:....:|...|.:.||..||..||.|.|.:||||:|..:.: |.:::.|..|||      |.
  Fly   142 LEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLK-GPYEEKYTNGFFKSKEIMNF 205

  Fly   200 HTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAHGDLW 264
            .....|.|:.|.::......|        |...:..:.|:|.|...........:|..|.|||.|
  Fly   206 FCDRSAKILLNNIDQYDGHAA--------YIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHGDGW 262

  Fly   265 TTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLTEA 329
            :.|.||||:.|...:|..|:|.|...|.|.|.||:||..:|...:::.|.....|.||:..|.:.
  Fly   263 SNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKH 327

  Fly   330 LRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRFKNSV 394
            |:.|.|:.::|:|...:........:|..||:....|:..:..:||..::::|:..|  .|.||:
  Fly   328 LKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKIISNEHS--NFTNSI 390

  Fly   395 YESENIKKKLSVTLPFLDQFGLLD 418
            |.:...::.:.|.||:|...|.|:
  Fly   391 YTNPRYRRHMKVVLPWLQHRGALE 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 84/294 (29%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 84/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55934
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.