DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and CG11889

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster

Alignment Length:420 Identity:290/421 (69%)
Similarity:350/421 (83%) Gaps:3/421 (1%)


  Fly     1 MTEKSTHKVHPAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTK 65
            |.||:||.   ||.|||.|||:.|||.|||:.:|.|..|..|||.|||.||.||||||:|||.||
  Fly     1 MPEKTTHN---APAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITK 62

  Fly    66 VSKGKQSTTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATM 130
            .||..||.|||:||||||:|||..:||:||:||||:|:||.|||:|||:|:.||.|||||||||:
  Fly    63 DSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATV 127

  Fly   131 NVDRERDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRG 195
            .||||||||:|||:||:.||||||.||||||||:|||||||.||||.:.||:||||||:||||||
  Fly   128 GVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG 192

  Fly   196 FFNKHTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAH 260
            |||||.|.|.|||.|:|:||||:|....:|.:||:||||||::.:||||||||:.:||||:||||
  Fly   193 FFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFVTLAH 257

  Fly   261 GDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYR 325
            ||:||||.|||||.:.||.|||||||||||||||||||.||||||:.:|||||.||||||||:|:
  Fly   258 GDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYK 322

  Fly   326 LTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSESGMRF 390
            |..||.::||:|::||||:||.|||::||||||.||||||.|.|.|||:.||||.::|.|.|:|.
  Fly   323 LVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKGVRL 387

  Fly   391 KNSVYESENIKKKLSVTLPFLDQFGLLDDM 420
            :::||::|...|||.:|||||||.||||:|
  Fly   388 RDAVYQTEENLKKLHLTLPFLDQLGLLDEM 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 210/288 (73%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 210/288 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130764122
eggNOG 1 0.900 E1_2CU9B
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.