DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and CG9497

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001260130.1 Gene:CG9497 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster

Alignment Length:436 Identity:120/437 (27%)
Similarity:198/437 (45%) Gaps:62/437 (14%)


  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77
            |..|...:.::.|.|..:.:.::|.::..:...:.|.||.|.:.|:.|.: .:....:|...|:|
  Fly    14 PSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSF-KRPDHPEQHMAFIV 77

  Fly    78 KT-------TFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRE 135
            |:       .|.|         ...||.:|...|..:||:|..:::...:...||:   ..:.:.
  Fly    78 KSIPHLDSVEFID---------DLQVYLKEKITYYEVLPRLELLMQCNRRFGPKLY---HYLKQP 130

  Fly   136 RDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKH 200
            .:|::|||::...:.:|.|...|:.||..||:|:||.|||.|..||...|.|||           
  Fly   131 ENSLVFEDLAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFD----------- 184

  Fly   201 TRAYAPIMTNLLEALSRSLASDEELGQRYKA--------------KIDRLVERLMDYG------- 244
              ||...|.:     .|.||.|:.|..::.:              ..:::.|::..|.       
  Fly   185 --AYGDGMLS-----PRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANL 242

  Fly   245 ERSTTSSPGDFLTLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDN 309
            |||......:...|.|||||..|.:|:||..:.|.:.|.||||.|||.||.|||:|||.|||...
  Fly   243 ERSQAPQEKEVKVLNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLE 307

  Fly   310 LRLEHQTELVQFYYYRLTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSL-IFEPVMQYEGK- 372
            :....:|:|::.|:.||.:.|..|.....:||......:...|..|..|.|. ||..|.|.:.: 
  Fly   308 VLRHRRTQLLRTYHARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFFASYGIFPTVSQDKAQT 372

  Fly   373 EDASIEQVLSSSESGMRFKNSVYESENIKKKLSVTLPFLDQFGLLD 418
            .|.::|....:..:..:.: .:::|..:...|..|||..::.|:||
  Fly   373 ADNNLENFKDADFAKQKVR-QMFQSRRLADTLRYTLPHFERAGVLD 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 95/316 (30%)
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 94/313 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59971
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.