DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and CG7135

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster

Alignment Length:423 Identity:118/424 (28%)
Similarity:194/424 (46%) Gaps:31/424 (7%)


  Fly    13 PVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLV 77
            |::||.::.:..|....:...|::..:........|.||.|.:.|..::|....|...: |:.:|
  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAME-TSLIV 72

  Fly    78 KTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAA-TM------NVDRE 135
            | :..|...|  :|....:|.:|...|.||.|:|..::.:.: ||   |:| |:      :..:.
  Fly    73 K-SMPDEKQA--ILARLHIYNKETLFYMHIKPKLEALMWRAV-DS---FSAWTLAPKHYYSTTQP 130

  Fly   136 RDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKH 200
            ..:||.||:....|::.||:..||.:|..||:.|||.:||.:.|:|||:|......|..|..:..
  Fly   131 EQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMD 195

  Fly   201 TRAYAPIM----TNLLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERSTTSSPGDFLTLAHG 261
            .....|..    |.||:.  .:|..|.|.......|:.|..|...:...::.....|:...|.||
  Fly   196 AINSEPFKLLFGTQLLKL--AALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHG 258

  Fly   262 DLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRL 326
            |||..|..|:|||:........||||...:.|...|::||.:|||:..:..:.:.|||..||..|
  Fly   259 DLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSL 323

  Fly   327 TEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEG--KEDASI----EQVLSSSE 385
            .:.|:.|.::..:||..|...:.|.|..|..|.:..|.|:|...|  .||.|:    ::..:..:
  Fly   324 VDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQK 388

  Fly   386 SGMRFKNSVYESENIKKKLSVTLPFLDQFGLLD 418
            ..:.|:.:....|::|    .||..||:..|.|
  Fly   389 VQLMFEGNTRTLESLK----CTLKRLDELKLFD 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 90/299 (30%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 89/297 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60058
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.