DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11878 and F58B4.5

Sequence 1:NP_651369.1 Gene:CG11878 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans

Alignment Length:440 Identity:92/441 (21%)
Similarity:159/441 (36%) Gaps:122/441 (28%)


  Fly    17 TSEYVQDKLRTYFKDSS---LKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTFLVK 78
            |:.:..||..|...|..   .|:|.::.|...|      |....:..::..|:|   ....|:..
 Worm    31 TATFGDDKTATNISDMKGFMSKIALVEPKWVGA------SENEELPEKFVVKIS---SQLPFIEM 86

  Fly    79 TTFAD-------RDPA-----GDV--LIHYGVYTREMDIYEHI-------LPQLADMVRKELKDS 122
            |...|       .|.|     |:|  |:|    .||:..|:.:       :|.......|...|.
 Worm    87 TKLMDFSSGDEFWDDAKLKGMGEVTRLLH----NREVATYKILMREKHPKIPFTKVYASKPFDDE 147

  Fly   123 RKLFAATM-----NVDR--ERDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVL 180
            .||.|..:     |:..  ..:||..||:.                   .|:..:|.|.|....|
 Worm   148 NKLKAYLISEYYPNIHHIGMHESIPAEDLI-------------------PVIHAIAAFSAIGMKL 193

  Fly   181 AERQPGIFDKNYDRG----------FFNKHTRAYAPIMTNLLEALSRSLASDEELGQRYKAKIDR 235
            :|.     :..|.||          |.::.:   ...|..||:|         ...:.|..|::.
 Worm   194 SEE-----ETKYARGADFLDIVFGQFMDEKS---IERMNVLLKA---------SFPEEYLEKVEE 241

  Fly   236 LVERLMDY--------GERSTTSSPGDFLTLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWN 292
            :::...||        ..::|....|....|.|.|||::||:...|.::....|| ||||.....
 Worm   242 MLKIYKDYYFQPQMIKNFKNTCQFFGYKPVLTHSDLWSSNFLCTRDGEKVTLKAI-IDFQTVSIT 305

  Fly   293 SPAIDLHYFFSTSLQDNLRLEHQTELVQFYYYRLTEALRKLKYAGRIPSLFDFQLQFRSRGFYAV 357
            :||.|:...|::.|....|.|....|::.||......|..:.    :|..|. ||:...:.::.:
 Worm   306 TPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNELDGMD----VPYTFQ-QLKDSYQVYFPL 365

  Fly   358 FCSLI---FEPVMQY-----EGKEDAS----------IEQVLSSSESGMR 389
            ..:::   ..|::|:     |.|:...          :|.|:::.||.::
 Worm   366 MTTMVLPGIAPMLQHSNVTEEYKDSMKQVALDKMIGLLEDVITTHESNIK 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 71/334 (21%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:285194 92/438 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.