DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG13618

DIOPT Version :8

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster

Alignment Length:254 Identity:84/255 (33%)
Similarity:140/255 (55%) Gaps:15/255 (6%)


  Fly     3 LTLALVLLFGCAS--TYGHASDFPSGIERC---AIMDEQCLEDRVNFVLRNYAKSGIKELGLIPL 62
            |.|.|:|:...|.  |...|.:.|.|..:|   |..| :||.|.||..::. .|:|.:|.|:.||
  Fly     6 LLLMLLLIAAVAQELTVTAAQELPEGFPKCKRDANFD-KCLVDAVNVAIQQ-LKAGNREFGIPPL 68

  Fly    63 DPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVA-KRVSGFTRDLSRSIELV-MEVPEIGVR 125
            :||.|||..|... ::|:|:..:...:.:   |..:: .::..:..||.:.:.:. .....|.:.
  Fly    69 EPLTVKKLVIDAG-NAPINLRQALKNVKV---HDMISTSKIQRYRTDLDKHLIICDSRTDRIEMI 129

  Fly   126 GPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQL 190
            |.|.:.||||:|||||:|.|::.|..||:..::..:...| |...|..:.:.:|..||..|....
  Fly   130 GDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEK-DGVKYMRLKDYRVSFDPKRVYMNF 193

  Fly   191 ENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLFV 249
            ||||| .|.||:.|:..:||||:.:|||||.|..::||:|.:.:.:::|.|:|.:.:|:
  Fly   194 ENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIFL 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 77/233 (33%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1398619
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.