DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG14457

DIOPT Version :8

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:272 Identity:70/273 (26%)
Similarity:117/273 (43%) Gaps:36/273 (13%)


  Fly     1 MELTLALVLLFGC--ASTYGHASDFPSGIERCAIMDE----------QCLEDRVNFVLRNYAKSG 53
            :||.:.||....|  .:..|...:.|..|:.|.|.|:          |.|.|::|        .|
  Fly     4 LELIVLLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLN--------DG 60

  Fly    54 IKELGLI-PLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGL-HQGVAKRVSGFTRDLSRSIELV 116
            |..|..| ..||.::.:.:|.:...:.:|:.:....:.|:|. |..|... ..|.:|.  |.:..
  Fly    61 IPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDS-QVFKKDY--SWKTT 122

  Fly   117 MEVPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVEL 181
            ..:||:.::..||:.||||::|:.|.|...:......|....|.:..|||.. |:..|.|:.|:.
  Fly   123 FTLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGF-TFYNVTNLHVDF 186

  Fly   182 DPSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPL-- 244
            ....:.....|||||.|.|.::.:...|:||:.:.:.|...|.:....|...|:.:||..:|.  
  Fly   187 KMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANF 251

  Fly   245 --------EQLF 248
                    |||:
  Fly   252 FVSDIPTPEQLY 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 64/251 (25%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1397440
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.