DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG33680

DIOPT Version :8

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:233 Identity:51/234 (22%)
Similarity:83/234 (35%) Gaps:61/234 (26%)


  Fly    27 IERCAIMDEQCLEDRVNFVLRNYAKSGIKELG----LIPLDPLHVKKFKIGRNPHSPVNIDLSFH 87
            :|||.|        ...:.:|.....|  .||    ..||:||.:.            ||:|.  
  Fly    45 LERCII--------NAAYQIRPLLVHG--NLGDGFPTSPLEPLSLD------------NIELK-- 85

  Fly    88 EMDILGLHQGVAKRVSGFTRDLSRSIELV---MEVPEIGVRGPYSVDGRILILPITGNGIADIRL 149
                                 ||...:.|   :|.......|.||:...:|:..|.|.|......
  Fly    86 ---------------------LSSQFQAVFKDLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYC 129

  Fly   150 TRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLFNGQKDLSENMHALINEN--- 211
            ...|...:|:..|..: :.:.|.:...:...:|......:|.|||:|.:.|.:..::|||.|   
  Fly   130 ENAKAFVKIRGSRYLR-NGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQEL 193

  Fly   212 -WKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPLEQLF 248
             .|||...|:.|:.:.|    ..|.|:|......:::|
  Fly   194 YLKDIAPSLEHGLSKHF----LDVADKILASATFDEMF 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 51/234 (22%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 51/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1401029
eggNOG 1 0.900 E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.