DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11854 and CG5945

DIOPT Version :8

Sequence 1:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster

Alignment Length:269 Identity:55/270 (20%)
Similarity:111/270 (41%) Gaps:46/270 (17%)


  Fly     1 MELTLAL--VLLFGCAST---YGHASDFPSGIERCAIMDEQ---CLEDRVNFVLRNYAKSGIKEL 57
            |..|:.|  :|..||::.   ..:.:|.|    :|:..::|   |::...| .|....|.|..||
  Fly     1 MYCTIGLLSLLALGCSAAPTDKNYFADLP----KCSTEEDQLGECVKQLFN-TLTPRLKDGNPEL 60

  Fly    58 GLIPLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVSGFTRDLSRSIELVMEVPEI 122
            .:.|.:|||:.:... :.....||..::.....|.|.....||.||.........:.||.::|::
  Fly    61 RIEPYEPLHLNRTSF-QYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQMPKL 124

  Fly   123 GVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVT 187
            .:.|.|..|.::..|.:...|..::.|        :.::.::..|.:.|        |.| .|..
  Fly   125 NIVGSYKADMQVNQLQLKPKGEFNVTL--------LDVEAITVTDGEVY--------EKD-GHRF 172

  Fly   188 YQLENLFNGQK---------------DLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDR 237
            ::|:|:.:..|               :|.:....:.|:.|:||:..:.|...:.:..:...:.:.
  Fly   173 FRLKNIDSKPKIKDLVIKANGIFADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNE 237

  Fly   238 IFGKLPLEQ 246
            .|..:|::|
  Fly   238 AFELVPIDQ 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11854NP_651358.4 JHBP 21..249 CDD:214779 49/245 (20%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 49/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403643
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.