DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11852 and CG33680

DIOPT Version :9

Sequence 1:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:222 Identity:48/222 - (21%)
Similarity:95/222 - (42%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CIINVSH----MLIRQHARTGYPSAGFPQVEPFLIKRFDISDGRTGSLNLKLN------FRDVNV 90
            ||||.::    :|:..:...|:|::   .:||..:          .::.|||:      |:|:..
  Fly    48 CIINAAYQIRPLLVHGNLGDGFPTS---PLEPLSL----------DNIELKLSSQFQAVFKDLEA 99

  Fly    91 EGLSSVKFDRAVGFGADPATSKFEMYGSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFS 155
            .|                        |::     .|||.....:|:..|:|.|:.:....|.|..
  Fly   100 NG------------------------GNY-----TGKYSLHLNLLLPDIKGKGNMQGYCENAKAF 135

  Fly   156 VKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHP 220
            ||.:.....|||:.|:...|:..|::.:...::|.|||:||:.||...|..:|:|......::.|
  Fly   136 VKIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDIAP 200

  Fly   221 SIHVAIAEIMKSVLSQLFKRFAYEDLF 247
            |:...:::....|..::.....::::|
  Fly   201 SLEHGLSKHFLDVADKILASATFDEMF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11852NP_651357.1 JHBP 9..248 CDD:284096 48/222 (22%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 48/222 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.