DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and svopb

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio

Alignment Length:190 Identity:37/191 (19%)
Similarity:78/191 (41%) Gaps:34/191 (18%)


  Fly   310 FFSS---NGMQLWFPEI--------VNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSK 363
            |||:   .|:.|...|:        |..:|..|:..|.:|:.|           |:|        
Zfish    43 FFSAFLYYGLVLLTTELFQAGSACGVTENSNIEHQCSLMCQHL-----------TID-------- 88

  Fly   364 TYIDNLVVGFAFLIGFSIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILL 428
            .|:|.|...||...|..:...::|.:.|:..::...::.|:. :|..:..:...||.:| ::|..
Zfish    89 DYLDLLWTTFAEFPGLLVALWMVNRISRRKSMVICFSLFTVC-ILPLYACTHRIVLTVF-IFIAR 151

  Fly   429 PGLSISIMIGAIV--DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMF 486
            ..::....|..:.  ::.||..|:..:.....:.|:|.:....:..|:|:.....|.:::
Zfish   152 TSINAGWQIAYVYTPEVFPTATRAIGIGTSSGMSRVGALVTPFIAQVLLKSSVYLTLSVY 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 35/178 (20%)
MFS 34..>189 CDD:119392
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 37/191 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.