DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and slc22a2

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_998315.1 Gene:slc22a2 ZFINID:ZDB-GENE-040426-2167 Length:562 Species:Danio rerio

Alignment Length:516 Identity:119/517 (23%)
Similarity:192/517 (37%) Gaps:155/517 (30%)


  Fly    15 WDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCEFETTQAEK---GVMMAAS 76
            |:||.|      |:..:|                           .||:....:.   .:..|..
Zfish   126 WEYDYV------GRQSFV---------------------------TEFDLVCGDAWYVDMFQATL 157

  Fly    77 VTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFV----LMFVTSVWLFNIINLLV-----GI 132
            ..|..:.:...||::|..||.:..|..||      |:    ::..||.   |.|:|||     |.
Zfish   158 SIGFLVGSIAIGYLADKYGRMKSFLMTNF------FIGVTGILVATSP---NYISLLVFRALFGF 213

  Fly   133 SVGAVSAALYAYLSEF-NIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPW 196
            .|.......|..::|. .:...|.|.:.|. :|.|:..:.:|..|:.:.:              |
Zfish   214 GVKGGWMVGYVLITELVGVDHRRTVGVTYQ-LFFSMGILLLPLLAYFITN--------------W 263

  Fly   197 RLLLLVSLLPGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEF 258
            |.|.:|..:| :|  ..|.||   ||||::||:|.|..||:|....|:|.|| |::.:.:.    
Zfish   264 RWLQVVFTVP-YI--CFLTYYWFIPESPRWLLTQNKIAEAVEITKSIAKENR-KTLSKKIE---- 320

  Fly   259 TLKSEDPVGENLLGESQGCGILSKICRATIPLFH--KPHGFNFILCNLALFGMFFSSNGMQLWFP 321
            |||.::              |.|....:.:.||.  |...:.|||          |.|    || 
Zfish   321 TLKDDN--------------IDSGSTASFMDLFKTAKLRTYTFIL----------SFN----WF- 356

  Fly   322 EIVNRSSGAENNSSTVCE--ILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGF-----AFLIGF 379
                       .|:.|.:  |:.:.:...||              |:|.|:.|.     ||||..
Zfish   357 -----------TSAVVYQGLIMRLGILGGNV--------------YVDFLISGIVELPAAFLILL 396

  Fly   380 SIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIV--- 441
            :|:     .:||:.....|..||..:.::..|:  |..:..|......:..|.|::....:|   
Zfish   397 TIE-----RIGRRLPFATANIVAGAACLITAFI--PDSMFWLKSAVACVGRLGITMAFEMVVFVN 454

  Fly   442 -DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501
             :|.||.:|:..||.|.:|..:|.|.|..|:..:...:......:|.....|...:|..||
Zfish   455 TELYPTVIRNLGVSVCSTLCDVGGIVAPFLLYRLAVIWLELPLIIFGALAFVAGGLVLLLP 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 109/475 (23%)
MFS 34..>189 CDD:119392 31/168 (18%)
slc22a2NP_998315.1 2A0119 12..525 CDD:273328 119/517 (23%)
MFS 146..515 CDD:119392 110/462 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60598077
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.