| Sequence 1: | NP_001097914.1 | Gene: | CG31103 / 43030 | FlyBaseID: | FBgn0051103 | Length: | 506 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_998315.1 | Gene: | slc22a2 / 406424 | ZFINID: | ZDB-GENE-040426-2167 | Length: | 562 | Species: | Danio rerio | 
| Alignment Length: | 516 | Identity: | 119/516 - (23%) | 
|---|---|---|---|
| Similarity: | 192/516 - (37%) | Gaps: | 155/516 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    15 WDYDMVLEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCEFETTQAEK---GVMMAAS 76 
  Fly    77 VTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFV----LMFVTSVWLFNIINLLV-----GI 132 
  Fly   133 SVGAVSAALYAYLSEF-NIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPW 196 
  Fly   197 RLLLLVSLLPGFIGGLILLYY---PESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEF 258 
  Fly   259 TLKSEDPVGENLLGESQGCGILSKICRATIPLFH--KPHGFNFILCNLALFGMFFSSNGMQLWFP 321 
  Fly   322 EIVNRSSGAENNSSTVCE--ILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGF-----AFLIGF 379 
  Fly   380 SIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIV--- 441 
  Fly   442 -DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLP 501  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG31103 | NP_001097914.1 | 2A0115 | 29..475 | CDD:273327 | 109/474 (23%) | 
| MFS | 34..>189 | CDD:119392 | 31/167 (19%) | ||
| slc22a2 | NP_998315.1 | 2A0119 | 12..525 | CDD:273328 | 119/516 (23%) | 
| MFS | 146..515 | CDD:119392 | 109/461 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588569 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||