DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and CG5592

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster

Alignment Length:458 Identity:99/459 (22%)
Similarity:155/459 (34%) Gaps:132/459 (29%)


  Fly    79 GIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYA 143
            |..:....:|:|:|..||...|...|..|.....|.:.......|.....:.|:|:......:|.
  Fly   149 GCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYI 213

  Fly   144 YLSEFNIPRHRAVAINYS-TMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPG 207
            ...|....::|.:..|.: |.|.::.|..:|   ||.           :|...||...:|..||.
  Fly   214 LTLENVGIKYRTLVGNLALTFFFTLGACLLP---WLA-----------YVISNWRHYAMVVALPI 264

  Fly   208 FIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFTLKSEDPVGENLLG 272
            ....|..|..||||.:|:|..|.:..||.:...:|.| ||.|                 .|.:..
  Fly   265 VFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKAN-GKII-----------------SEEVWS 311

  Fly   273 ESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTV 337
            |.:.|                   :.....|..| |..::|..:...||.:|            |
  Fly   312 EMREC-------------------YELKFANEQL-GKQYTSLDLFKTFPRLV------------V 344

  Fly   338 CEILSVP--------VEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLI--------- 385
            ..||.|.        .....|.|.|| ||                ..|.||:..|:         
  Fly   345 LTILIVTWMTVALAYDAHVRVVEILD-TD----------------IFITFSLSSLVEIPAGIVPM 392

  Fly   386 --LNPLGRKNVLLAALAVATLSGVLL-----HFMESPTGVLVLFCLYILLPGLSISIMIGA--IV 441
              |:.:|||.::.|.:.:...|.:.:     |:..|...:...|.       .:::..:|.  ..
  Fly   393 LLLDRIGRKPMMSAVMLLCAASSLFVGILKGHWNASTAAIAARFF-------ATMAYNVGQQWAS 450

  Fly   442 DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTT------FAMFTCTLIVCI--VIVH 498
            :::||.||.:.         |.||.....||.:|.|...:|      ..||..||:..|  :|:.
  Fly   451 EILPTVLRGQG---------LAIINIMGQMGALLSPLVLSTHRYYRPLPMFIITLVSVIGALIIL 506

  Fly   499 YLP 501
            :||
  Fly   507 FLP 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 88/423 (21%)
MFS 34..>189 CDD:119392 23/111 (21%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 99/459 (22%)
MFS 141..509 CDD:119392 98/457 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49791223
eggNOG 1 0.900 E1_KOG0255
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24064
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.