DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and Svopl

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_011239688.1 Gene:Svopl MGIID:2444335 Length:544 Species:Mus musculus

Alignment Length:519 Identity:114/520 (22%)
Similarity:210/520 (40%) Gaps:110/520 (21%)


  Fly    21 LEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIA-----SQCEFETTQAEKGVMMAASVTGI 80
            :|.||:|:....|.|:.|     |....:||.|::||     .:||::....:...:......|.
Mouse    38 VETIGFGRFHIALFLIMG-----STGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGY 97

  Fly    81 FLSTYIWGYISDDIGRRRVL----LYGNFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAAL 141
            .:|:.::|.::|..||.::|    |:|.:.|....|...:   :| |..:..:||..|...:..|
Mouse    98 MVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSY---IW-FVFLRTMVGCGVSGHAQGL 158

  Fly   142 YAYLSEFNIPRHRAVAINYSTMF--------VSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRL 198
             ...:||...::|...:..|.:|        :|:.::.:|             |:|      ||.
Mouse   159 -IIKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIP-------------TIG------WRW 203

  Fly   199 LLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNR-----GKSIQQVLSCDEF 258
            |:.::.:||.|..:...:.|||.:|.:|......|:..:..|:|.||     |:.::.:|     
Mouse   204 LIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPIL----- 263

  Fly   259 TLKSEDPVGENLLGESQG--CGIL-SKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWF 320
                          |.:|  ..:| ||..|.|:.::            :...|:.|:..|:.|..
Mouse   264 --------------EKRGRFADLLDSKYLRTTLQIW------------IIWLGISFAYYGVILAS 302

  Fly   321 PEIVNRS--SGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVG-FAFLIGFSIQ 382
            .|::.|.  .|:::.|            :|.|.||...:....|..|....... :..:|..::.
Mouse   303 AELLERDLVCGSKSES------------EPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLG 355

  Fly   383 GLILNP--------LGRKNVLLAALAVATLSGVLLHFMESPTGVL-VLFCLYILLPGLSISIMIG 438
            .:.|||        |||:..|...:....|..:||:...|..|:: .||.|..|:.....:|.| 
Mouse   356 EIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYI- 419

  Fly   439 AIVDLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIVIVHYLPI 502
            ...::.||.:|:..:....||.|:|.:.|..:..|::.........:|:...:||.:....|||
Mouse   420 YTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQVLMSASFLGALCLFSSVCVVCAISAFTLPI 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 104/483 (22%)
MFS 34..>189 CDD:119392 35/172 (20%)
SvoplXP_011239688.1 2A0115 34..456 CDD:273327 108/491 (22%)
MFS 51..482 CDD:119392 107/504 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60887421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.