DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and Slc22a24

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_775424.1 Gene:Slc22a24 RGDID:628885 Length:551 Species:Rattus norvegicus

Alignment Length:555 Identity:109/556 (20%)
Similarity:203/556 (37%) Gaps:153/556 (28%)


  Fly     5 LESNTLGPN---VWDYDMVL------------EKI-GYGKTQWVLLLVSGLL-TITSVAAQQAMS 52
            |::||:..|   :...|.:|            ||. .|.:.||.||.::|.. |:|....:..:.
  Rat    54 LDNNTMSDNNSRILSQDDLLRISIPMDSNLRPEKCRRYIQPQWDLLHLNGTFSTVTEPDTEPCVD 118

  Fly    53 IIVIASQCEFETT----------QAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFAS 107
            ..|........||          |....|.....:||||:...:.|::||..||:.::..|....
  Rat   119 GWVYDQSTFLSTTVTQWDLVCGSQTLNSVAKFIYMTGIFIGHLMGGHLSDKFGRKFIVTCGLLTL 183

  Fly   108 NALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRA--VAINYSTMFVSVTAI 170
            ...:..:.|..:..::..:..|.|||...:.......:.|:..|:.:|  :|:.:|...:....:
  Rat   184 AVTETSVAFAPTFLIYCSLRFLTGISSSCIRTNSALLILEWTSPKFQAMVMALIFSAGGIGQVLL 248

  Fly   171 YVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIE 235
            .|.|                |..|.|:.|.|...:|.|...:...:..||.::|:...|..|.::
  Rat   249 GVLA----------------FGIRNWQHLQLAMSVPVFFLLIPTRWLSESARWLIITNKPQEGLK 297

  Fly   236 AVAWISKFNRGKSIQQVLSCD--EFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPH--- 295
            .:..::..|..|:.:.||:.:  :.|:|.|....|..              .:.:.||..|:   
  Rat   298 ELIKVAHINGIKNSRDVLTLEVVKTTMKDELEAAETK--------------PSPLVLFRTPNLRK 348

  Fly   296 ---GFNFILCNLALFGMFFSSNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCT 357
               ..:|:.| ::|.                           |||..::::..            
  Rat   349 RICLLSFVRC-VSLI---------------------------STVGLLINLQY------------ 373

  Fly   358 DPISSKTYIDNLVVGF----AFLIG-FSIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTG 417
              :|:|.::...:.|.    |.|:| ||     :|.:||:...:..::|..:|.:.:.|:...  
  Rat   374 --LSNKVFLLQCLYGVVCTPANLLGNFS-----MNYMGRRTTQIIFMSVMGISILSITFLTQE-- 429

  Fly   418 VLVLFCLYILLPGLSISIMIGAIV------------DLVPTHLRSKAVSFCMSLGRLGIIAATNL 470
                    :.:|.|.::.:.|||.            :||||.:|:.|         ||:|.....
  Rat   430 --------MQIPRLVLASLGGAISSASLTSTAVLSNELVPTVIRATA---------LGVIGIFGS 477

  Fly   471 MGVMLQPYCNTTFAMFTCTLIVCIVIVHYLPIRNS 505
            .|..|.|   ....:.|.:..:..:|...|||.:|
  Rat   478 AGAALSP---LLMILMTYSASLPWIIYGVLPILSS 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 92/484 (19%)
MFS 34..>189 CDD:119392 31/168 (18%)
Slc22a24NP_775424.1 2A0119 11..525 CDD:273328 109/556 (20%)
MFS 151..506 CDD:119392 86/454 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.