DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and svop

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_012825291.1 Gene:svop XenbaseID:XB-GENE-939906 Length:610 Species:Xenopus tropicalis

Alignment Length:527 Identity:122/528 (23%)
Similarity:208/528 (39%) Gaps:95/528 (18%)


  Fly     5 LESNTLGPNVW-----DYDMV---LEKIGYGKTQWVLLLVSGLLTITSVAAQQAMSIIVIASQCE 61
            ||..|..|..:     |..||   :|.||:||.||.|.:::||..:........:||:.....||
 Frog   112 LEDGTTVPREFANPTDDTFMVEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCE 176

  Fly    62 FETTQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRR--------VLLYGNFASNALQFVLMFVT 118
            :.....:..::.:....|:..|:.:||.:||..|||.        .|.||..::.|..:      
 Frog   177 WRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVY------ 235

  Fly   119 SVWLFNIINLLVGISVGAV--SAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLS 181
             .|:. ::..|||..:|.|  |..|||   ||...:.||..|....:|.::..::....|..|:.
 Frog   236 -SWIL-VLRGLVGFGIGGVPQSVTLYA---EFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMP 295

  Fly   182 SNWAITMGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRG 246
                 |:|      ||.||::|.||.|:..::..:.|||.::.:......:|:..:..|:..|..
 Frog   296 -----TLG------WRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGA 349

  Fly   247 KSIQQVLSCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFF 311
            ..                |:|:.::...:..|   ||.....|.|.:    ..:|.....|...|
 Frog   350 PM----------------PLGKLIVSRQEDRG---KIRDLFSPQFRR----TTLLLWFIWFSNAF 391

  Fly   312 SSNGMQLWFPE---------IVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYID 367
            |..|:.|...|         |.|:....:...|..||.|:|                   :.|.|
 Frog   392 SYYGLVLLTTELFQAGDVCSISNQRKAVKPKCSLACEYLTV-------------------EDYTD 437

  Fly   368 NLVVGFAFLIGFSIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYILLPGLS 432
            .|....:...|..|...|::.:|||..:.....|.:|..:|| |:.....||.:| |:|....:|
 Frog   438 LLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLL-FLCVGRNVLTVF-LFIARAFIS 500

  Fly   433 ISIMIGAIV--DLVPTHLRSKAVSFCMSLGRLGIIAATNLMGVMLQPYCNTTFAMFTCTLIVCIV 495
            .......:.  ::.||..|:..:..|..:.|:|.:....:..|||:.....|..:::...::..:
 Frog   501 GGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYLTVLVYSGCCVLAAL 565

  Fly   496 IVHYLPI 502
            ...:|||
 Frog   566 ASCFLPI 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 105/467 (22%)
MFS 34..>189 CDD:119392 38/165 (23%)
svopXP_012825291.1 2A0119 75..581 CDD:273328 122/528 (23%)
MFS 151..571 CDD:119392 105/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.