DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31103 and LOC100334012

Sequence 1:NP_001097914.1 Gene:CG31103 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_002667419.4 Gene:LOC100334012 ID: Length:594 Species:Danio rerio

Alignment Length:543 Identity:107/544 (20%)
Similarity:188/544 (35%) Gaps:159/544 (29%)


  Fly    13 NVWDYDMVLEKIGYGK----------TQWVLLLVSGLLTITSVAAQQAMSIIVIASQCEFETTQA 67
            |..|.|:.:|....|.          ::|...|.|||       .|..::...:....|::...|
Zfish    87 NGTDRDLFVEAFANGTDNSFVTACLCSEWRFDLQSGL-------QQNVVTKWTLVCDGEWKVHIA 144

  Fly    68 EKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLLVGI 132
             |..::..|:.|..|    .|.::|.:||..|||....:.......:.|...:.:|:.:....|.
Zfish   145 -KFSLLVGSIFGYLL----MGAMADWLGRIPVLLVSVLSVLVFGLAVAFSVDMSMFSTLRFFEGF 204

  Fly   133 SVGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWR 197
            .:.||...||....|..:|:.|......:::.:....:.:|..|.|.              |.|:
Zfish   205 CLAAVRLTLYVLRIELCLPKWRFSMTMIASLIMVGGQLLMPGLAALC--------------RDWQ 255

  Fly   198 LLLLVSLLPGFIGGLILLY---YPESPKFLLSQEKNNEAIEAVAWISKFNRGKSIQQVLSCDEFT 259
            :|.:|.:.| |:  |:|.|   :|||.::||:.:....|...:..|::.|         :.|..|
Zfish   256 ILQIVIIAP-FV--LMLPYVWMFPESLRWLLATQHYQRAKRQMYRIAQKN---------NVDTAT 308

  Fly   260 LKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIV 324
                ||           .||||::   ...|..||.                         ...|
Zfish   309 ----DP-----------SGILSEL---ETELQQKPK-------------------------TSCV 330

  Fly   325 NRSSGAEN---NSSTVC--EILSVPVEQPNVTETLDCTDPISSKTY-------IDNLVVGFAFLI 377
            .:.||..|   |:..:|  .:....:....|...|:  |..|...|       :.:.:|.|..:.
Zfish   331 TQLSGTRNLWKNTVVLCVNSLTGYGIHHCFVRSVLE--DSASHLHYYALAAIAVSSCMVLFPVVG 393

  Fly   378 GFSIQGLILNPLGRKNVLLAALAVATLSGVLLHFMESPTGVLVLFCLYIL--------------- 427
            ||          ||:..||:.:.:..|:.:|      ..|:|.|...|.:               
Zfish   394 GF----------GRRGGLLSFMIITALASLL------QLGLLNLIGKYSIRHDAVLRDTLNRRFS 442

  Fly   428 ----LPGLSISIMIGAI-----VDLVPTHLRSKAVSFCMSLGRLGIIAAT-----NLMGVMLQPY 478
                :.|:..|..:..:     .::.||.:|...|...::....|::.|.     |..|..|.  
Zfish   443 YAFSIIGMFSSHAVSTLSIFYCAEITPTVIRGGGVGLVLASAGFGMLTAPLMELHNQKGFFLH-- 505

  Fly   479 CNTTFAMFTCTLIVCIVIVHYLP 501
                ..:.||..::||:.:..||
Zfish   506 ----HVILTCCTLLCIICIPLLP 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 95/490 (19%)
MFS 34..>189 CDD:119392 31/155 (20%)
LOC100334012XP_002667419.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.