DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and ECEL1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_004817.2 Gene:ECEL1 HGNCID:3147 Length:775 Species:Homo sapiens

Alignment Length:739 Identity:152/740 (21%)
Similarity:263/740 (36%) Gaps:195/740 (26%)


  Fly   150 SAPPECSDPICEA-VASSIQARLNWNKDPCTEFKKFSC--W---RNTPNKNIT--NLIEMGNSQK 206
            :.|..|.:....| .|..:.|.|:.:.|||.:|..|:|  |   ...|:..:|  .:..:|...:
Human    94 ACPEGCPERKAFARAARFLAANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNE 158

  Fly   207 SVDSQMLY--------LFQNKIMNGSFGILHNLFESCLQ----QTTNSTVMHRIFDSLGGYLPVG 259
            ....::|.        ..|.|:        ...|.|||.    :......|..:.:..||:    
Human   159 ERLRRLLARPGGGPGGAAQRKV--------RAFFRSCLDMREIERLGPRPMLEVIEDCGGW---- 211

  Fly   260 SVGPSSIAPLIAKIYDL-----------GPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERK 313
            .:|.:...|.:|..:||           ..:.|..|  .:|...|.....:|.......|:.||.
Human   212 DLGGAEERPGVAARWDLNRLLYKAQGVYSAAALFSL--TVSLDDRNSSRYVIRIDQDGLTLPERT 274

  Fly   314 IRWMSPKAPPSRI-------RQGVPKLL-ADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQV 370
            : :::......:|       .:.|..|| ||.:|          |:..|   |.:..:.|..:.|
Human   275 L-YLAQDEDSEKILAAYRVFMERVLSLLGADAVE----------QKAQE---ILQVEQQLANITV 325

  Fly   371 -EHS--RRGFWDSTVLYN---VSSLQDLYPVLNWTLLIPQ------NWSGPIVVRNSDYLKALEY 423
             ||.  ||   |.:.:||   :..||.:.|.|.|..|:.|      :....:|:..:||::.:..
Human   326 SEHDDLRR---DVSSMYNKVTLGQLQKITPHLRWKWLLDQIFQEDFSEEEEVVLLATDYMQQVSQ 387

  Fly   424 FLTKYPTRVAHNSL-----LLLS---------ALQILPRDYPSPE-------VCTRSTMWALPEL 467
            .:...|.||.||.|     ::||         ||..|.::....:       ||...........
Human   388 LIRSTPHRVLHNYLVWRVVVVLSEHLSPPFREALHELAQEMEGSDKPQELARVCLGQANRHFGMA 452

  Fly   468 SSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHL-KRAPSL-------KGAALVKLSALKIQSQTWE 524
            ..:|::.:|.|...|   .:.:.:.:.:|..| :|...|       :.||..||..:.:. ..:.
Human   453 LGALFVHEHFSAASK---AKVQQLVEDIKYILGQRLEELDWMDAETRAAARAKLQYMMVM-VGYP 513

  Fly   525 GFSNTTDLLKSLQPLNITSECWFQNIL----------------EIYKKNKLEPNDISLNGGSHDA 573
            .|....|.:.......:..:.:|:|||                |:.|...|.|            
Human   514 DFLLKPDAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLP------------ 566

  Fly   574 WAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDE---- 634
               |.....:|....:.:|.|..::....::...|..|:|..:|..|..|    :|..:|:    
Human   567 ---PQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHE----LTHGYDDWGGQ 624

  Fly   635 --------------------KAMRCVPHSVNIFSNYSRM--------DILIHSGGMQISYHSMLS 671
                                :...|:....:.|:.|::.        :.:...||::::||:...
Human   625 YDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYHAYQK 689

  Fly   672 LT---GPIKGMARLPGLNLTPTQIFFLVSAQELC----AESNYLGI--DTNAPEFDNILGWLVAQ 727
            ..   ||   ...||.|..|..|:||:..||..|    ::|.||.:  |.:|||...:|| .|:|
Human   690 WVREHGP---EHPLPRLKYTHDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLG-SVSQ 750

  Fly   728 GGSATEVFKCPSGSMINVQKTCNV 751
            .......|.||..|.:|....|:|
Human   751 FEEFGRAFHCPKDSPMNPAHKCSV 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 144/709 (20%)
ECEL1NP_004817.2 PepO 115..766 CDD:226118 144/709 (20%)
M13 120..773 CDD:189000 145/711 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.