DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Ece1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_006239337.1 Gene:Ece1 RGDID:620293 Length:769 Species:Rattus norvegicus

Alignment Length:846 Identity:169/847 (20%)
Similarity:292/847 (34%) Gaps:259/847 (31%)


  Fly    62 DEIEMIDS-------ANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTL-- 117
            ||.:::||       .|....|.|..::   |..|.|    .|||  |.|..:...|||...|  
  Rat    26 DEEDLVDSLSEGDVYPNGLQVNFRSPRS---GQRCWA----ARTS--VEKRLVVLVTLLAAGLVA 81

  Fly   118 -LVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEF 181
             |.|..|.:...|                      ||.|....|.:|.|||...::...|||.:|
  Rat    82 CLAALGIQYRTRT----------------------PPVCLTEACVSVTSSILNSMDPTVDPCQDF 124

  Fly   182 KKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTV 244
            ..::|  |..      .|.:..|:|:                   :|...||:|.      |..:
  Rat   125 FSYACGGWIK------ANPVPDGHSR-------------------WGTFSNLWEH------NQAI 158

  Fly   245 MHRIFDSLGGYLPVGSVGPSSIAPLIAKIY-----------DLGPSPLVDLYHDLS--------- 289
            :..:.::        |...:|.|...|::|           :|...||::|...|.         
  Rat   159 IKHLLEN--------STASASEAEKKAQVYYRACMNETRIEELRAKPLMELIEKLGGWNITGPWA 215

  Fly   290 --------------YGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQ------GVP--- 331
                          |...|...:.:|..|.:|.               |.:.|      |:|   
  Rat   216 KDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSN---------------SNVIQVDQSGLGLPSRD 265

  Fly   332 ---------KLLADLIENFLPYFVSYAQRVSEKD---------TIFEFIKDLNKLQVEHSRRGFW 378
                     |:|.    .:|.|.|...:.:...|         .|.:|...|..:.:...:|.  
  Rat   266 YYLNKTENEKVLT----GYLNYMVQLGKLLGGGDEDSIRPQMQQILDFETALANITIPQEKRR-- 324

  Fly   379 DSTVLYN---VSSLQDLYPVLNW-----TLLIPQ--NWSGPIVVRNSDYLKALEYFLTKYPTRVA 433
            |..::|:   .:.||.|.|.:||     .:..|.  |.|.||||.:.:||:.:...:......:.
  Rat   325 DEELIYHKVTAAELQTLAPAINWLPFLNAIFYPVEINESEPIVVYDKEYLRQVSTLINSTDKCLL 389

  Fly   434 HNSL---LLLSALQILPRDY-------------------PSPEVCTRSTMWALPELSSSLYIAQH 476
            :|.:   |:......|.:.:                   |..:.|...|...|......:::...
  Rat   390 NNYMMWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKAT 454

  Fly   477 SSEDLKDTTKRAEIIFKSLKAHLKRAPSLK-------GAALVKLSALKIQSQTWEGFSN----TT 530
            .:||.|:..  :|||.:..||..:...:||       .:|..|..|:    ....|:.|    ..
  Rat   455 FAEDSKNIA--SEIILEIKKAFEESLSTLKWMDEDTRRSAKEKADAI----YNMIGYPNFIMDPK 513

  Fly   531 DLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAY--PIVSTIFYDTLSHSIVV 593
            :|.|.........:.:|:|.:..:..:.....|......:.|.|:.  |:|:. :|....:.||.
  Rat   514 ELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNA-YYSPTKNEIVF 577

  Fly   594 PLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDEKA---------------------- 636
            |..::..|::....|..|::..:||.:..|    :|.:||::.                      
  Rat   578 PAGILQAPFYTRSSPNALNFGGIGVVVGHE----LTHAFDDQGREYDKDGNLRPWWKNSSVEAFK 638

  Fly   637 --MRCVPHSVNIFS--------NYSRMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQ 691
              ..|:....|.:|        .::..:.:..:||::.:|.:..:..........||.|.||..|
  Rat   639 QQTECMVQQYNNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEQILPTLGLTSNQ 703

  Fly   692 IFFLVSAQELCA----ESNYLGI--DTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCN 750
            :|||..||..|:    ||::.|:  |.::|....::|.| :.....:|.|:||.||.:|.:..|.
  Rat   704 LFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSL-SNSKEFSEHFRCPLGSPMNPRHKCE 767

  Fly   751 V 751
            |
  Rat   768 V 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 136/719 (19%)
Ece1XP_006239337.1 PepO 105..769 CDD:226118 142/737 (19%)
M13 118..767 CDD:189000 137/721 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.