DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and MMEL1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_258428.2 Gene:MMEL1 HGNCID:14668 Length:779 Species:Homo sapiens

Alignment Length:820 Identity:175/821 (21%)
Similarity:287/821 (35%) Gaps:255/821 (31%)


  Fly   112 LLVTTLLVASPILFLI---STAPSPLPRDCYMDGDR---------CSPAVSAPPECSDPICEAVA 164
            ||||..|||..:|:..   ...|....|.|::..:|         ...|......|:.|.|...|
Human    34 LLVTAALVALGVLYADRRGKQLPRLASRLCFLQEERTFVKRKPRGIPEAQEVSEVCTTPGCVIAA 98

  Fly   165 SSIQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQM---LYLFQNKIMNGS 224
            :.|...::...:||.:|.:|:|  |..      .::|...||:.|:...:   |.:....::..|
Human    99 ARILQNMDPTTEPCDDFYQFACGGWLR------RHVIPETNSRYSIFDVLRDELEVILKAVLENS 157

  Fly   225 FG-------ILHNLFESCLQQTT----NSTVMHRIFDSLGGYLPVG------SVG-----PSSIA 267
            ..       ....|:.||:.|:.    .|..:..|.:.:||: ||.      :||     ...:|
Human   158 TAKDRPAVEKARTLYRSCMNQSVIEKRGSQPLLDILEVVGGW-PVAMDRWNETVGLEWELERQLA 221

  Fly   268 PLIAKIYDLGPSPLVDLY---HDLSYGRRPHILLI----ISGPSTSSTI---LERKIRWMSPKAP 322
            .:.::   .....|:||:   .|.:..|  ||:.|    :..||.....   ..||:|       
Human   222 LMNSQ---FNRRVLIDLFIWNDDQNSSR--HIIYIDQPTLGMPSREYYFNGGSNRKVR------- 274

  Fly   323 PSRIRQGVPKLLADLIENFLPYFVSYAQRVSE-----KDT---------IFEFIKDLNKLQVEHS 373
                            |.:|.:.||.|..:.|     :|:         :.|....|.|..|...
Human   275 ----------------EAYLQFMVSVATLLREDANLPRDSCLVQEDMVQVLELETQLAKATVPQE 323

  Fly   374 RRGFWDSTVLYNVSSLQDLYPV-----LNWTLLIPQNWSG---------PIVVRNSDYLKALEYF 424
            .|  .|...||:...|::|...     .||||.|....|.         .:||....||:.||..
Human   324 ER--HDVIALYHRMGLEELQSQFGLKGFNWTLFIQTVLSSVKIKLLPDEEVVVYGIPYLQNLENI 386

  Fly   425 LTKYPTRVAHNSL---LLLSALQILPRDYPSPEVCTRSTMWA------------------LPELS 468
            :..|..|...|.|   |:|..:..|.:.:....|..|..::.                  :....
Human   387 IDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRVNYRKALFGTMVEEVRWRECVGYVNSNMENAV 451

  Fly   469 SSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSL-------KGAALVKLSALKIQSQTW--- 523
            .|||:.:....|.|...:  |:|.|.....::....|       |..|..|  |:.|:.|..   
Human   452 GSLYVREAFPGDSKSMVR--ELIDKVRTVFVETLDELGWMDEESKKKAQEK--AMSIREQIGHPD 512

  Fly   524 -----------EGFSNTTDLLKSLQPLNITSECWFQNILEIYK----------KNKLEPNDISLN 567
                       |.:||          ||.:.:.:|:|.|:..|          :.|::||     
Human   513 YILEEMNRRLDEEYSN----------LNFSEDLYFENSLQNLKVGAQRSLRKLREKVDPN----- 562

  Fly   568 GGSHDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSI--- 628
                 .|.. ..|...||....:.||.|..::..|:|:...|..|::..:|:.|..||....   
Human   563 -----LWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKEQPQALNFGGIGMVIGHEITHGFDDN 622

  Fly   629 ------------------TKSFDEKAMRCVPHSVNIFSNYSRMDI---------------LIHSG 660
                              |:.|.|:: .|:.:.   :.||| .|:               :..:|
Human   623 GRNFDKNGNMMDWWSNFSTQHFREQS-ECMIYQ---YGNYS-WDLADEQNVNGFNTLGENIADNG 682

  Fly   661 GMQISYHSMLSLTGPIKGMA------RLPGLNLTPTQIFFLVSAQELCAESNY--------LGID 711
            |::.:|.:.|      |.||      :||||:||..|:||:..||..|  .:|        :..|
Human   683 GVRQAYKAYL------KWMAEGGKDQQLPGLDLTHEQLFFINYAQVWC--GSYRPEFAIQSIKTD 739

  Fly   712 TNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            .::|....:||.|......| :.|.|..|:.::.::.|.|
Human   740 VHSPLKYRVLGSLQNLAAFA-DTFHCARGTPMHPKERCRV 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 155/741 (21%)
MMEL1NP_258428.2 PepO 102..779 CDD:226118 157/753 (21%)
M13 111..777 CDD:189000 156/741 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.