DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and ece1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001071260.1 Gene:ece1 ZFINID:ZDB-GENE-061110-100 Length:752 Species:Danio rerio

Alignment Length:825 Identity:167/826 (20%)
Similarity:311/826 (38%) Gaps:218/826 (26%)


  Fly    62 DEIEMIDSANIENFNTRYNKNSI---IGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVASPI 123
            :|.|::|:.:...::|...:..:   :|..|     |...:.:..|:.:     ||..|.||   
Zfish    10 EEEELLDTGSDGIYHTSSMQVGVQRGLGLRC-----WAEKNHSERKLVV-----LVCALSVA--- 61

  Fly   124 LFLISTAPSPLPRDCYMDGDRCSPAV------SAPPECSDPICEAVASSIQARLNWNKDPCTEFK 182
            ||:                  |..::      |.|..|....|.:|||::...|:.:.|||.:|.
Zfish    62 LFI------------------CIVSLGLHYKESHPGLCLSEPCVSVASAVLGSLDRSVDPCQDFY 108

  Fly   183 KFSC--W-RNTPNKNITNLIEMGNSQKSVDSQM----LYLFQNKIMNGSFGILHN-------LFE 233
            .|:|  | |..|       :..|.|:....|.:    :.:.:|.:.|.|...|..       .::
Zfish   109 NFACGGWMRKNP-------LPEGKSRWGPFSNLWEHNMAVMKNLLENTSMKSLSRAEQKAQWYYQ 166

  Fly   234 SCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPLVDLYHDL-SYGRR---- 293
            :|:.:                                :||.:||..||.||.:.. .:|.:    
Zfish   167 ACMNE--------------------------------SKIEELGAKPLQDLINQTGGWGLKGPWE 199

  Fly   294 ----PHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQ------GVPK----LLADLIENFLPY 344
                ..:|.|:|....:|......:...| |:..|.|.|      |:|.    |.....|.:|..
Zfish   200 KDNFQEVLRIVSANFRTSPFFTVFVSTDS-KSSNSNIIQVDQSGLGLPSREYYLNKTANEKYLNA 263

  Fly   345 FVSY----------AQRVSEK--DTIFEF---IKDLNKLQVEHSRRGFWDSTVLYNVSS--LQDL 392
            ::::          :|..|:|  :.|.||   :.::...|||  ||.  :..:.|.:.:  |..|
Zfish   264 YLNFLVELGVLLGGSQDTSQKMMEEIIEFETTLANITVPQVE--RRD--EEKIYYKIQAKELATL 324

  Fly   393 YPVLNWTLLIPQ-------NWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLLL---LSALQILP 447
            .|.::|...:..       |.|.|:||...:||:.:...::.....|.:|.:::   ...:.||.
Zfish   325 APAIDWMPFLSSVFAPVELNNSEPVVVYAKEYLQKVSELISNTNKSVLNNYMIMKVVRKMVSILD 389

  Fly   448 RDY-------------------PSPEVCTRSTMWALPELSSSLYIAQHSSEDLK----DTTKRAE 489
            :.:                   |..::|...|..||.....:|::....|||.|    |.....:
Zfish   390 QKFQDAEQRFLEVMYGTKKSCMPRWKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIK 454

  Fly   490 IIFK-SLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEI 553
            ..|: |||......|..|.||..|..|:.......:...|..:|.|.....::.|:.:|||::..
Zfish   455 WAFEDSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVMNY 519

  Fly   554 YKKNKLEPNDISLNGGSHDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVG 617
            |..:.....|......:.|.|:. |.....:|:...:.:|:|..:...|::|...|..:::..:|
Zfish   520 YNFSARVTADQLRKAPNRDQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPKAMNFGGIG 584

  Fly   618 VSIAKEILRSITKSFDEKAMR------------------------CVPHSVNIFSNYS------- 651
            |.:..|    :|.:||::..:                        |:   |..:||||       
Zfish   585 VVMGHE----LTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCM---VEQYSNYSINNEPLN 642

  Fly   652 ----RMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCA----ESNYL 708
                ..:.:..:||:..:|.:.::........|.||.|.:...|:||:..||..|:    ||::.
Zfish   643 GKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQVWCSVRTPESSHE 707

  Fly   709 GI--DTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |:  |.::|....::| .::.....:|.|.|.:.|.:|.::.|.:
Zfish   708 GVITDPHSPSRFRVIG-TISNSHEFSEHFGCKADSPMNPKRKCEL 751

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 142/699 (20%)
ece1NP_001071260.1 PepO 94..752 CDD:226118 144/711 (20%)
M13 101..750 CDD:189000 143/701 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.