DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Ecel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_068544.1 Gene:Ecel1 RGDID:61806 Length:775 Species:Rattus norvegicus

Alignment Length:740 Identity:153/741 (21%)
Similarity:256/741 (35%) Gaps:198/741 (27%)


  Fly   150 SAPPECSDPICEA-VASSIQARLNWNKDPCTEFKKFSC--W---RNTPNKNIT--NLIEMGNSQK 206
            :.|..|.:....| .|..:.|.|:.:.|||.:|..|:|  |   ...|:..:|  .:..:|..  
  Rat    95 ACPEGCPERKAFARAARFLSANLDASIDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQ-- 157

  Fly   207 SVDSQMLYLFQNKIMNGSFGI----LHNLFESCLQ----QTTNSTVMHRIFDSLGG--------- 254
              :.:.|.....:...|..|.    :...|.|||.    :......|..:.:..||         
  Rat   158 --NEERLRRLLARPTGGPGGAAQRKVRAFFRSCLDMREIERLGPRPMLEVIEDCGGWDLGGAADR 220

  Fly   255 ------------YLPVGSVGPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSS 307
                        |...|....:::..|...:.|...|..| :..|......|...|.::....|.
  Rat   221 PGAARWDLNRLLYKAQGVYSAAALFSLTVSLDDRNSSRYV-IRIDQDGLTLPERTLYLAQDEGSE 284

  Fly   308 TIL-------ERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQR-----VSEKDTIFE 360
            .:|       ||.:|.:.                ||.:|......:...||     |||.|    
  Rat   285 KVLAAYKVFMERLLRLLG----------------ADAVEQKAQEILQLEQRLANISVSEYD---- 329

  Fly   361 FIKDLNKLQVEHSRRGFWDSTVLYN---VSSLQDLYPVLNWTLLIPQ------NWSGPIVVRNSD 416
               ||.:           |.:.:||   :..||.:.|.|.|..|:.|      :....:|:..:|
  Rat   330 ---DLRR-----------DVSSVYNKVTLGQLQKITPHLQWKWLLDQIFQEDFSEEEEVVLLATD 380

  Fly   417 YLKALEYFLTKYPTRVAHNSL-----LLLS---------ALQILPR-----DYPS--PEVCTRST 460
            |::.:...:...|.|:.||.|     ::||         ||..|.:     |.|.  ..||....
  Rat   381 YMQQVSQLIRSTPRRILHNYLVWRVVVVLSEHLSPPFREALHELAKEMEGNDKPQELARVCLGQA 445

  Fly   461 MWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHL-KRAPSL-------KGAALVKLSALK 517
            .........:|::.:|.|...|   .:.:.:.:.:|..| :|...|       |.||..||..:.
  Rat   446 NRHFGMALGALFVHEHFSAASK---AKVQQLVEDIKYILGQRLEELDWMDAQTKAAARAKLQYMM 507

  Fly   518 IQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGG--------SHDAW 574
            :.    .|:   .|.|  |:|..:..|..|:...:.|.||.|.....|:...        ....|
  Rat   508 VM----VGY---PDFL--LKPEAVDKEYEFEVHEKTYLKNILNSIRFSIQLSVKKIRQEVDKSTW 563

  Fly   575 AYPIVS-TIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFDE---- 634
            ..|..: ..:|....:.:|.|..::....::...|..|:|..:|..|..|    :|..:|:    
  Rat   564 LLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHE----LTHGYDDWGGQ 624

  Fly   635 ---------------------KAMRCVPHSVNIFSNYSRM--------DILIHSGGMQISYHSML 670
                                 || .|:....:.|:.|::.        :.:...||::::|::..
  Rat   625 YDRSGNLLHWWTEASYSRFLHKA-ECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYYAYQ 688

  Fly   671 SLT---GPIKGMARLPGLNLTPTQIFFLVSAQELC----AESNYLGI--DTNAPEFDNILGWLVA 726
            ...   ||...:.|   |..|..|:||:..||..|    ::|.||.:  |.:|||...:|| .|:
  Rat   689 KWVREHGPEHPLHR---LKYTHNQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLG-SVS 749

  Fly   727 QGGSATEVFKCPSGSMINVQKTCNV 751
            |.......|.||..|.:|....|:|
  Rat   750 QFEEFGRAFHCPKDSPMNPVHKCSV 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 145/710 (20%)
Ecel1NP_068544.1 PepO 112..766 CDD:226118 146/714 (20%)
M13 121..773 CDD:189000 146/712 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.