DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and mmel1

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_017213856.1 Gene:mmel1 ZFINID:ZDB-GENE-101112-2 Length:765 Species:Danio rerio

Alignment Length:800 Identity:176/800 (22%)
Similarity:291/800 (36%) Gaps:196/800 (25%)


  Fly    98 TSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRC------SPAVSAPPECS 156
            |....|:..:....|.|..||::..:..||....|.| |:.:...|..      |.|.|  ..|:
Zfish    15 TKPRKHRWTVVEIGLSVIVLLMSCALAGLIVLYTSAL-RERFNINDSSKGLKYRSDADS--NVCT 76

  Fly   157 DPICEAVASSIQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSV-----DSQMLY 214
            .|.|...|:.:...::.:.|||..|.:::|  |..      .::|...:|..||     |...:.
Zfish    77 TPQCVTAAARLLQNMDPSVDPCQNFYQYACGGWIE------RHVIPETSSLHSVFNILRDELEIV 135

  Fly   215 L-----FQNKIMNGSFGILHNLFESCLQ----QTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLI 270
            |     .:||....:|.....|:.||:.    :..:|..:.|:.||:|.:            |:.
Zfish   136 LKGVLEMENKDDREAFKKAKTLYSSCMNEILIEQRDSQPLLRLIDSIGDW------------PVA 188

  Fly   271 AKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRI------RQG 329
            ::::: |.|.......|        .|.:::|......:||..: |...:.....|      ..|
Zfish   189 SEVWN-GTSEQTWSLED--------TLAVLNGRYNKKAVLEMFV-WPDDRDSSRYIIHVDQPALG 243

  Fly   330 VPK---LLAD-----LIENFLPYFVSYAQRVSEKD---------------TIFEFIKDLNKLQVE 371
            :|.   .|:|     :.|.:|.:.||.| |::.:|               .:.|...|:......
Zfish   244 MPSRDYYLSDGNYKKVREAYLEFMVSMA-RIAREDRNLTQDEERVLEDMSQVLELETDIANATSP 307

  Fly   372 HSRRGFWDSTVLYNVSSLQDLYPV-----LNWTLLIPQNWSG---------PIVVRNSDYLKALE 422
            ...|.  |.|||||..:|::....     .|||..|....|.         |||:..|.||:.|.
Zfish   308 AEERN--DITVLYNKMTLREAQQTFNLNGFNWTRYIQGIMSSVSISVQSDEPIVIYCSPYLEKLS 370

  Fly   423 YFLTKYPTRVAHNSL---LLLSALQILPRDYPSPEV------------------CTRSTMWALPE 466
            ..|:|:..|...|.|   |::..:..:.|.:.....                  |.|.....:..
Zfish   371 EVLSKHSHRTLQNYLVWMLIMDRVSSMSRRFKDVRAHYRKALHGTTVEEARWRDCVRYVQGNMEN 435

  Fly   467 LSSSLYIAQHSSEDLKDTTKR--AEIIFKSLKAHLKRAPSL-----KGAALVKLSALKIQSQTWE 524
            ...:||:    .|.....:||  .|:|.|..:|:::....|     :.....:..|:.|..|.  
Zfish   436 AVGALYV----RETFSGNSKRMVGELIKKIQEAYVETLEELSWMDEQSKVKAREKAMAISEQI-- 494

  Fly   525 GF------SNTTDLLKSLQPLNITSECWFQNILEI--------YKKNKLEPNDISLNGGSHDAWA 575
            |:      .....|.:....||.:.|.:|:||||.        :||.: ||.|       .|.|.
Zfish   495 GYPDHILEEENKKLDQEYAHLNFSEENYFENILENLAASAQKGHKKLR-EPVD-------PDMWI 551

  Fly   576 Y-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSIT---KSFD--- 633
            . ..|...||....:.||.|..::..|:|:......|::..:|:.|..||.....   ::||   
Zfish   552 IGAAVVNAFYSHNRNQIVFPAGILQPPFFSEKQLQALNFGGIGMVIGHEITHGFDDHGRNFDKDG 616

  Fly   634 --------------EKAMRCVPHSVNIFS-------NYSRMDIL----IHSGGMQISYHSMLSLT 673
                          |...:|:......||       |.|.:..|    ..:||::.:|.:.:...
Zfish   617 NMYNWWSNYSAERFEDQSKCMVEQYGRFSWKLAGGQNVSGITTLGENIADNGGVRQAYKAYVKWV 681

  Fly   674 GPIKGMARLPGLNLTPTQIFFLVSAQELC--AESNY----LGIDTNAPEFDNILGWLVAQGGSA- 731
            .......|||||::...|:|||..||..|  ....|    :..|.::|....:||.|  |...| 
Zfish   682 EREGEEPRLPGLDMNHKQLFFLNFAQVWCGACRPEYAIQTIKTDPHSPLEYRVLGSL--QNFEAF 744

  Fly   732 TEVFKCPSGSMINVQKTCNV 751
            :|.|.|..|:.:|.::.|.|
Zfish   745 SEAFHCARGAPMNPEEKCRV 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 155/713 (22%)
mmel1XP_017213856.1 PepO 88..765 CDD:226118 157/724 (22%)
M13 95..763 CDD:189000 156/715 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.