DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and PHEX

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_000435.3 Gene:PHEX HGNCID:8918 Length:749 Species:Homo sapiens

Alignment Length:795 Identity:151/796 (19%)
Similarity:270/796 (34%) Gaps:253/796 (32%)


  Fly   118 LVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPE-CSDPICEAVASSIQARLNWNKDPCTEF 181
            ||...||||:|.....|               .|..| |..|.|...|::|.:::|.:.|||..|
Human    31 LVLGTILFLVSQGLLSL---------------QAKQEYCLKPECIEAAAAILSKVNLSVDPCDNF 80

  Fly   182 KKFSC--------------------W-RNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSF 225
            .:|:|                    | |:..:..:..|:|...|::. |::.:.  :.||:..|.
Human    81 FRFACDGWISNNPIPEDMPSYGVYPWLRHNVDLKLKELLEKSISRRR-DTEAIQ--KAKILYSSC 142

  Fly   226 GILHNLFESCLQQTTNSTVMHRIFDSLGGYLPV--GSVGPSSIAPLIAKIYDLGPSPLVDLYHDL 288
                 :.|..:::.....::|.:..|...: ||  .::||..:                      
Human   143 -----MNEKAIEKADAKPLLHILRHSPFRW-PVLESNIGPEGV---------------------- 179

  Fly   289 SYGRRPHILL----IISGPSTSSTILERKIRWMSPKAPPS-----RIRQGVPKLLA--DLIENFL 342
             :..|...||    ...|..::|..:.   .::||....|     ::.|....|..  |.::|  
Human   180 -WSERKFSLLQTLATFRGQYSNSVFIR---LYVSPDDKASNEHILKLDQATLSLAVREDYLDN-- 238

  Fly   343 PYFVSYAQRVSEKDTIFEFIKD-------------------------LNKLQVEHSRRGFWDSTV 382
                 ..:..|.:|.:::|:.|                         :.::.:.|..|   .|..
Human   239 -----STEAKSYRDALYKFMVDTAVLLGANSSRAEHDMKSVLRLEIKIAEIMIPHENR---TSEA 295

  Fly   383 LY---NVSSLQDLYPVLNW---------TLLIPQ----NWSGPIVVRNSDYLKALEYFLTKYPTR 431
            :|   |:|.|..:.|..:|         |.|.|.    :.|..:|||...|.|.|...|.....:
Human   296 MYNKMNISELSAMIPQFDWLGYIKKVIDTRLYPHLKDISPSENVVVRVPQYFKDLFRILGSERKK 360

  Fly   432 VAHNSL---LLLSALQILPRDY------------------PSPEVCTRSTMWALPELSSSLYIAQ 475
            ...|.|   ::.|.:..|.|.:                  |..:.|......|||.:...:::..
Human   361 TIANYLVWRMVYSRIPNLSRRFQYRWLEFSRVIQGTTTLLPQWDKCVNFIESALPYVVGKMFVDV 425

  Fly   476 HSSEDLKDTTKR---------AEIIFKS---LKAHLKRAPSLKG-AALVKLSALKIQSQTWEGFS 527
            :..||.|:..:.         .:::.|.   :.|..||....|. |.|.|:...       |...
Human   426 YFQEDKKEMMEELVEGVRWAFIDMLEKENEWMDAGTKRKAKEKARAVLAKVGYP-------EFIM 483

  Fly   528 NTTDLLKSLQPLNITSECWFQNILEIYK---------KNKLEPNDISLNGGSHDAWAYPIVSTIF 583
            |.|.:.:.|:.:..:...:|.|:|:..|         ..|..|..        :.:..|.....|
Human   484 NDTHVNEDLKAIKFSEADYFGNVLQTRKYLAQSDFFWLRKAVPKT--------EWFTNPTTVNAF 540

  Fly   584 YDTLSHSIVVPLSVILIPYF-NAVLPPYLHYASVGVSIAKEILRSI------------------T 629
            |...::.|..|...:..|:| ....|..|.|.::||.:..|.....                  |
Human   541 YSASTNQIRFPAGELQKPFFWGTEYPRSLSYGAIGVIVGHEFTHGFDNNGRKYDKNGNLDPWWST 605

  Fly   630 KS---FDEKAMRCVPHSVNIFSNY----SRMDI---------LIHSGGMQISYHS--------ML 670
            :|   |.||. :|:   :|.:|||    :.:::         :..:||::.::.:        ..
Human   606 ESEEKFKEKT-KCM---INQYSNYYWKKAGLNVKGKRTLGENIADNGGLREAFRAYRKWINDRRQ 666

  Fly   671 SLTGPIKGMARLPGLNLTPTQIFFLVSAQELC------AESNYLGIDTNAPEFDNILGWLVAQGG 729
            .|..|:     |||:..|..|:|||..|...|      |....:.|..::|....:.| .::...
Human   667 GLEEPL-----LPGITFTNNQLFFLSYAHVRCNSYRPEAAREQVQIGAHSPPQFRVNG-AISNFE 725

  Fly   730 SATEVFKCPSGSMIN 744
            ...:.|.||..|.:|
Human   726 EFQKAFNCPPNSTMN 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 135/737 (18%)
PHEXNP_000435.3 M13 74..747 CDD:189000 135/738 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.