DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl21

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651646.2 Gene:Nepl21 FlyBaseID:FBgn0027578 Length:707 Species:Drosophila melanogaster

Alignment Length:752 Identity:143/753 (19%)
Similarity:294/753 (39%) Gaps:167/753 (22%)


  Fly   105 MAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQA 169
            :.|..|..:::.::.|:|      |:...|.:|              .|...:.:.:|..:.|::
  Fly    13 LCICIAGHVLSAMVAAAP------TSEEDLKQD--------------TPYMKELLRQAKTAEIES 57

  Fly   170 RLNWNKDPCTEFKKFSCWRNTPNKNITNLIEM--------GNSQKSVDSQMLYLFQNKIMN---- 222
            .::...|||.:|..|||..   .|.|.:.:.|        ....|.::.::|     |::|    
  Fly    58 FMDQKADPCNDFYAFSCGN---YKRINSALSMQVVTTGVFETLTKGLNRKIL-----KMLNTPHD 114

  Fly   223 -----GSFGILHNLFESCLQ-QTTNSTVMHRIFDSLG--GYLPV--GSVGPSS----IAPLIAKI 273
                 ....:.| .:||||| :..|||...::...:.  |.:|:  ||.....    :.......
  Fly   115 SHDTPEDIKVKH-FYESCLQIKELNSTYSEKLKRLIAEFGTMPLLEGSSWQEDDFDWLNTTARMA 178

  Fly   274 YDLGPSPL--VDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSR--IRQGVPKLL 334
            |..|.:|:  :::..||:...|..|.|     ......||.:..::.......|  .|..:.::|
  Fly   179 YRYGITPIFGIEVNKDLASNTRNRIYL-----GQQDFPLEARSMYVDDATAVYRQKYRNNIQRIL 238

  Fly   335 ADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSR-RGFWDSTVLYNVSSLQDLY-PVLN 397
                :.:|...:..|::.:::  :.:|..||.:..|:.|. ....:.|.|..|..:|..| |.|:
  Fly   239 ----QRYLGVKMDLAKKTAKE--LIDFEVDLAQGLVDESEGLDVGELTQLLTVDEIQRRYSPTLD 297

  Fly   398 WTLLI----PQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPE---- 454
            ...|:    .:..|..|...|:.|.:.|...:.:.|.|...|.:......:.:.....|||    
  Fly   298 IDRLLFVSMGERISDQIYEYNNRYQQNLVEVIKRTPKRTVANYIFFRLIWEFVETPSDSPEKQMK 362

  Fly   455 VCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKA----HLKRAPSL-------KGA 508
            .|...|.....:...:::..::::|   .:::..:.:::.||:    .|:.:|:|       :..
  Fly   363 ACVDLTKKYFAKNLDNMFYRRYNNE---KSSREIDNMWRQLKSTFNETLRSSPALNWIERPTRNL 424

  Fly   509 ALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSH-- 571
            |:.||.|:.::...:...:.|.:..:    ||:.|:.:.:|:           ...||.|...  
  Fly   425 AMAKLQAMTLEVNNYADDNFTEEFAE----LNLQSDDYVENV-----------RYTSLLGAKQMR 474

  Fly   572 -----DAWAYPIVSTIFYD----TLSHSIVVPLSVILIPYF--NAVLPPYLHYASVGVSIAKEIL 625
                 .|..:...|.:.|.    .:.::|.||:: :|.|::  :.|.|..:.:.::...|..|::
  Fly   475 EMLHKPAKPFEAGSQLSYTPANILIENTIKVPVA-LLQPFYIWSDVYPNAIMFGTLASLIGHELI 538

  Fly   626 RSITKS---FDEKAM-------------------------RCVPHSVNIFSNYSRMDILIHSGGM 662
            .....|   ||||..                         |.|...:.:..:.::.:.:..:|||
  Fly   539 HGFDDSGRKFDEKGNSKDWWDEKSSSNFLKRRDCFTKQYGRYVYDGIQLKESTAQSENIADNGGM 603

  Fly   663 QIS-------YHSMLSLTGPIKGMAR--LPGLNLTPTQIFFLVSAQELCAESN------YLGIDT 712
            :::       |.:.|:|....:.|.:  ||.|..|..|:||:..||..|.:::      .:..|.
  Fly   604 RLAYTAYRKWYENQLTLPNGAQDMTKETLPNLRYTAKQLFFISFAQSWCNDAHPSVKALQVSTDQ 668

  Fly   713 NAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
            :.|....::|.| :.....::.|.||:||.:|..:.|
  Fly   669 HMPGRFRVIGSL-SNFEEFSKEFNCPAGSAMNPSEKC 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 132/680 (19%)
Nepl21NP_651646.2 PepO 57..707 CDD:226118 133/689 (19%)
M13 63..704 CDD:189000 132/681 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.