DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl20

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651645.1 Gene:Nepl20 FlyBaseID:FBgn0039613 Length:700 Species:Drosophila melanogaster

Alignment Length:779 Identity:151/780 (19%)
Similarity:297/780 (38%) Gaps:210/780 (27%)


  Fly    93 CIWLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSD 157
            |||:             |:.:::.|::|:|      |:...|.:|              .|...:
  Fly     7 CIWI-------------ASHVLSVLVLAAP------TSEDVLNQD--------------TPYMKE 38

  Fly   158 PICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEM--------GNSQKSVDSQMLY 214
            .:.:|.|:.|::.:|...|||.:|..|||..   .|.|.:.:.|        ....|.::.::| 
  Fly    39 LMRQAKAAEIESFMNQKVDPCKDFYAFSCGN---YKRINSALNMRVLTTGVFETLTKGLNRKIL- 99

  Fly   215 LFQNKIMN---------GSFGILHNLFESCLQ-QTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPL 269
                |::|         ....:.| .:||||| :..|||...:                  :..|
  Fly   100 ----KMLNTPHDSHDTPEDIQVKH-FYESCLQIKELNSTYSEK------------------LKRL 141

  Fly   270 IAKIYDLGPSPLVD-----------LYHDLSYGRRPHILLIIS-GPSTSSTILERKIRWMSPKAP 322
            ||   :.|..||::           |........|..|:.||. |.:|.....::.|.:::.:..
  Fly   142 IA---EFGTMPLLEGSSWQEDDFDWLNTTARMAHRYGIMSIIGVGVATDFANNQKNIIYINQQEF 203

  Fly   323 PSR------------IRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRR 375
            |.:            .||.....:..::|.:|......|::.:::  :|||..||....|::::.
  Fly   204 PLKTRSMYMDNETAIYRQNYQNNIQLILEKYLGVKDELARKAAKE--MFEFEVDLAHGLVDNNKH 266

  Fly   376 -GFWDSTVLYNVSSLQDLY-PVLNWTLLI----PQNWSGPIVVRNSDYLKALEYFLTKYPTRVAH 434
             ...|...|..|:.|::.| |.|:...||    .:..|..:...|..|.:.|...:.:.|.....
  Fly   267 LNLRDLIELLTVAELRERYAPTLDTDQLIFVSMGEKISDKVYEYNRRYQQNLVEVIERTPKSTVA 331

  Fly   435 NSLLLLSALQILPRDYPS------PEVCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFK 493
            |.|.|....:.:.:  ||      .|.|...|.....:...::...::.:|   .:::..:.::.
  Fly   332 NYLFLRLIWEFIQK--PSGVAEKPTEACVDFTKTYFAKNLDNMIYRRYKNE---KSSREIDSMWH 391

  Fly   494 SLKAHLKRA-----------PSLKGAALVKLSA--LKIQSQTWEGFS--------NTTDLLKSLQ 537
            .||:..|..           ||.:..|:.||.|  |::.:...|.|:        ..||.:::|:
  Fly   392 QLKSTFKETLLSSPALDWIEPSTRSLAIAKLEAMTLEVNNYVKENFTEEFADLNLQNTDCVENLR 456

  Fly   538 PLNITSECWFQNILEIYKK--NKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILI 600
            .:.:...   :.:.::|.:  ..||..::         .:|...:.:    |.:||.||:: :|.
  Fly   457 QVQMLQA---KQMRQLYHQPAKPLEAGEL---------LSYTPSNIL----LENSIKVPVA-LLQ 504

  Fly   601 PYF--NAVLPPYLHYASVGVSIAKEILRSITKS---FDEKAM----------------------- 637
            |::  :.|.|..:.:.::...|..|::.....|   ||||..                       
  Fly   505 PFYIWSDVYPNAVMFGTLAYLIGHELIHGFDDSGRKFDEKGNSKDWWDEKSSSNFLKRRDCFTKQ 569

  Fly   638 --RCVPHSVNIFSNYSRMDILIHSGGMQIS-------YHSMLSLTGPIKGMAR--LPGLNLTPTQ 691
              |.|...:.:..:.::.:.:..:|||:::       |.:.|:|....:.|.:  ||.|..|..|
  Fly   570 YGRYVYDGIQLKESTAQSENIADNGGMRLAYTAYRKWYENQLTLPNGAQDMTKETLPNLRYTAKQ 634

  Fly   692 IFFLVSAQELC------AESNYLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
            :||:..||..|      .::..:..|.:.|....::|.| :.....::.|.|.:||.:|..:.|
  Fly   635 LFFISFAQSWCNDVHPKVKALQVSTDDHMPGKFRVIGTL-SNFEEFSKEFNCHAGSAMNPIEKC 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 135/695 (19%)
Nepl20NP_651645.1 PepO 50..691 CDD:226118 135/696 (19%)
M13 56..697 CDD:189000 135/696 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.