DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl18

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651643.1 Gene:Nepl18 FlyBaseID:FBgn0039611 Length:682 Species:Drosophila melanogaster

Alignment Length:754 Identity:151/755 (20%)
Similarity:269/755 (36%) Gaps:238/755 (32%)


  Fly   147 PAVSAPPECSDPICEAVASS------IQARLNWNK-------DPCTEFKKFSCWRNTPNKNITNL 198
            ||::.|.:..||..:.:.|.      :||::...|       .||.:|...:|            
  Fly    17 PAMAKPSDAGDPFADDLTSDYAKKIIVQAKVAEMKTMMKPEVSPCDDFYTHAC------------ 69

  Fly   199 IEMGNSQKSVDSQMLYLFQNKIMNGSFGILHNLFESCLQ--------QTTNSTVMHRIFDSLG-- 253
               ||..:...:|:|    ..:|..:|.::...|:..||        |:.....|.|.:.|..  
  Fly    70 ---GNWHRHNPAQLL----GDVMTDNFKLISKGFDRRLQRLLRANDLQSELEKKMQRFYMSCNLV 127

  Fly   254 ------------------GYLP--VGSVGPSSIAP---LIAKI-YDLGPSPLV--DLYHDL---S 289
                              |.||  ||:...||...   .:|:| :..|...::  ::.||:   |
  Fly   128 HRDDVHYKLALENVIREYGTLPALVGAQWNSSDFSWWRTVAQIQHKYGKQIIIGLEIMHDIRNTS 192

  Fly   290 YGRRPHILLIISGP-----STSSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYA 349
            ..|     :.||.|     :|..|.|..::|....                  ::.:.....|.|
  Fly   193 VNR-----VYISQPDFKTINTRLTNLMEEVRTSMD------------------LQQYFGLSSSVA 234

  Fly   350 QRVSEKDTIFEFIKDLNKLQVEHSRRG-----FWDSTVLYNVSSLQDLY-PVLNWT-----LLIP 403
            :..:|:         |.:|:...|..|     ..:|..||.|:.||:.| ..||:|     :|..
  Fly   235 KHTAEQ---------LTELERTFSSGGSGAATLQESLSLYTVADLQEKYSDHLNFTEFLGLILGE 290

  Fly   404 QNWSGPIVVRNSDYL-KALEYFLTKYPTRVAHNSLLLLSAL------QILPRDYPSPEVCTRSTM 461
            :|....:.:.:.:|| |||   ||...|.:|..:..:|..|      ...|:|  ..:.||.||.
  Fly   291 ENIPKSLYIYDEEYLDKAL---LTMRSTPLATQANYVLWKLLEDFLVDAQPKD--MVKWCTESTK 350

  Fly   462 WALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKR----------APSLKGAALVKLSA- 515
            ....:|:......::.:.|::....:   |:..:|...::          :.:.:..|:.||.. 
  Fly   351 KYFGKLAEHAVYKRYRNPDVESEVHK---IWDQIKGIFRQRLLGDKLDWISNATRTLAIEKLERM 412

  Fly   516 -LKIQSQTWEGFSNT--------TDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSH 571
             |.|.|...|.|.|.        .:.:.::|.|.|.     :.|..:.:.|  :|.|      |.
  Fly   413 HLNINSYDEENFENVYGEVFIDRLNYVSNVQQLLIA-----KGIRFVARIN--QPAD------SV 464

  Fly   572 DAWAYPIVSTIFYDTLSHSIVVPLSVILIPYF-NAVLPPYLHYASVGVSIAKEILRSIT---KSF 632
            ||... :..|..|:...::|.:|::::...|| ....|..|.||::|..:|.|:|....   :.:
  Fly   465 DATEL-LGFTPAYNIQENNITIPVALLQPRYFWGDQYPEALKYATLGYLLAHEMLHGFDDDGRQY 528

  Fly   633 D-----------------EKAMRC--------------VPHSVNIFSNYSRMDILIHSGGMQISY 666
            |                 |:..:|              :|.|.:...|      :..|||::::|
  Fly   529 DASGNLAPWWDLKSRYEFEERRKCFQAQYHEYQYGGSKLPESKDQSEN------IADSGGLKLAY 587

  Fly   667 HSMLSLTG----PIKGMARLPGLNLTPTQIFFLVSAQELCAESNYL------GIDTNAPEFDNIL 721
            .:.....|    .:.....:.||.....|:|||..||.||.:..:|      ..|.:||....::
  Fly   588 AAYELWLGQQSEEVLQRETMEGLPFNSRQLFFLGYAQLLCDDVQFLFQPWVSQSDRHAPSKYRVI 652

  Fly   722 G---------WLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            |         |          ||.|...:.::.:..|.:
  Fly   653 GPLSNFQEFPW----------VFNCSQSAPMDPEYKCAI 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 141/709 (20%)
Nepl18NP_651643.1 PepO 54..682 CDD:226118 142/718 (20%)
M13 58..679 CDD:189000 141/710 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.