DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl17

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651641.1 Gene:Nepl17 FlyBaseID:FBgn0039609 Length:681 Species:Drosophila melanogaster

Alignment Length:758 Identity:145/759 (19%)
Similarity:275/759 (36%) Gaps:203/759 (27%)


  Fly   109 SATLLVTTLLVASPIL--FLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARL 171
            ||.|:..||.|.|..:  .:.....:||       |.:......:...||             .:
  Fly     7 SACLIFVTLAVGSLAIQGGVFKELTTPL-------GQQIMRIAKSAEMCS-------------FM 51

  Fly   172 NWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILHN------ 230
            :.:..||.:|..::|....       .|....|||..:.:.| :|.|.:.... .:|:.      
  Fly    52 DTSVSPCDDFYGYACGNYA-------TINAATSQKDTNIRQL-MFANYLRRVR-QVLNEPRISTD 107

  Fly   231 ---------LFESCLQ----QTTNSTVMHRIFDSLGGYLPVGS-----VGPSSIAPLIAKIYDLG 277
                     .:||||.    :|...:.:..:....||...|..     ||..:|..:...:...|
  Fly   108 RPMEVRVKYFYESCLDTAALRTKQRSHLLSVLREFGGMPAVEGKSWDYVGFDAIEMMAQLLRRYG 172

  Fly   278 PSPLVDLY----------HDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPK 332
            ...|:.:|          ..|..|:|..:     ..|.....|.:|.      |...|:|     
  Fly   173 KLTLLGVYVVPDHFNSQIKRLQLGQRLDL-----AESDEFASLWKKY------ALKMRLR----- 221

  Fly   333 LLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTV---------LYNVSS 388
                   |.|......|::.:|         ::.:|::|.||..| |..:         |..:|:
  Fly   222 -------NLLGLSEELARKTAE---------EIIELELELSRSAF-DHRMNRDPRLMRHLTMLSN 269

  Fly   389 LQDLY-PVLNWTLLIPQNWSG-----PIVVRNSDYLKALEYFLTKYPTRVAHNSLL--LLSALQI 445
            :.|.| |:||.|..: .:|.|     |:......||..::..|...|..|..|.:|  ||:..:|
  Fly   270 MSDAYGPILNVTRFV-TSWLGSEYNLPVFESVPSYLFQVKKILLSTPNHVVANYMLSSLLTDFEI 333

  Fly   446 LPRDYPSPEVCTRSTMWALPELSSSLYIAQHSSED----LKDTTKRAEIIFKSLKAHLKRAPSLK 506
            ...:.....:|........|::..  ::..||.|.    :.:..:...:..||....:..:|.::
  Fly   334 TANEEQQKVICHERITELFPDVVD--HMVYHSLEQQNPYIANEMRSLWVELKSSFREMLSSPDIE 396

  Fly   507 GAALVKLSALKIQSQTWEGFSNTTDLLKSL----------QPLN---------ITSECWFQNI-- 550
            .          ::.||.|      :||:.|          |.:|         ::|..::.||  
  Fly   397 W----------LEKQTRE------ELLEKLNGMSFEIAGGQAVNFEEQFGDLVVSSADYYGNIQR 445

  Fly   551 -LEIYKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPY-FNAVLPPYLHY 613
             ||:  |.::...|: |...|...:.:.:.:|..|:|.::.:|:|:|.:...| ::.:.|..|.|
  Fly   446 LLEV--KARILRTDL-LRESSSVYYYHGVTATPIYETETNLVVLPVSYMQHRYLWDDIYPAALKY 507

  Fly   614 ASVGVSIAKEILRSI--------------------TKSFDEKAMRCVPHSVN--IFSNY------ 650
            .::|.::|.|:....                    ||...|....|:....:  ::.|.      
  Fly   508 GTLGFTMAHEMAHGFDDLNRLYDSRGNLNDNWSTQTKVGFELVKNCLADQFSGMLYGNLRLRRLK 572

  Fly   651 SRMDILIHSGGMQI---SYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAE------SN 706
            |:.:.:..:.|::|   :|...|... .::....||.:..:|.|:|||.:||.:|::      :|
  Fly   573 SQAESIADNVGIRIAQSAYWKWLDQV-EMEETESLPHMTQSPEQLFFLSAAQFMCSDIYPERRAN 636

  Fly   707 YLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
            ::..:.:.|....:...::.....| |.|:|.:.|.:|....|
  Fly   637 FVRNNFHPPYEARVFAMMINSPAFA-EAFQCSNSSKMNPPNKC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 132/688 (19%)
Nepl17NP_651641.1 PepO 49..672 CDD:226118 132/702 (19%)
M13 55..678 CDD:189000 132/689 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.