DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep7

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651603.1 Gene:Nep7 FlyBaseID:FBgn0039564 Length:717 Species:Drosophila melanogaster

Alignment Length:714 Identity:149/715 (21%)
Similarity:276/715 (39%) Gaps:184/715 (26%)


  Fly   167 IQARLNWNKDPCTEFKKFSC--WRN--TPNKN---ITNLIEMGNSQKSVDSQMLYLFQNKI---M 221
            :::.:|::.|||.:|.:|:|  |:|  ||.::   .:|::::..:...|..|:  |.:.|:   :
  Fly    58 MKSYMNFSVDPCDDFYEFACGNWKNVKTPRQSPHRRSNILDISYTLMDVTEQL--LTRTKLAEAL 120

  Fly   222 NGSFGIL--HNLFESCL-----QQTTNSTVMHRIFDSLGGYLPVG----SVGPSSIAPLIAKIYD 275
            |.|..:|  ...:.|||     .:.........:..||||:..|.    :....|...:.|.:.:
  Fly   121 NVSAELLVAQRFYNSCLAAELFPRPAADPAYLSVIRSLGGFPAVDRDAWNASSFSWFNMSAHLSN 185

  Fly   276 LGPSPLVDLYHDLSYGRRP-------------HILLIISGPSTSS---TILERKIR-----WMSP 319
            .|...|:   |:....:.|             |::......:|||   .:.|.::|     :...
  Fly   186 YGVRSLI---HEEILPQHPFNPYFKLPELGFDHVVHTAHVANTSSRAYQLNEHRMRGYLKEYNLT 247

  Fly   320 KAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKD----LNKLQVEHSRRGFWDS 380
            |...|.:.:||              |..:::.:|.:|. ||..:|    |:::: |..|.|.|.|
  Fly   248 KDEISAVIEGV--------------FAFWSEALSIEDK-FESDRDKCDLLSEIE-EVPRFGQWRS 296

  Fly   381 TVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSD-------YLKALEYFLTKYPTRVA-HNSL 437
              .|.::                  |:|......|.       |...|:....|:...|| :.::
  Fly   297 --YYEIA------------------WNGIDFYNGSSGGEFCDFYYVELDKVCAKHTEAVANYLAM 341

  Fly   438 LLLSALQILPRDYPSPE----VCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEI---IFKSL 495
            ..|..:....::...||    .|.......||.|.:.||:|:|.:::     |.:||   :.:..
  Fly   342 RFLYRMDDKLKEPKQPEDQKVNCLMIVQMTLPNLFNRLYMAEHFTDE-----KHSEISDMVTEMR 401

  Fly   496 KAHLKRAPSL-------KGAALVKLSALK--IQSQTWEGFSNTTDLLKSLQPLNITSECWFQNIL 551
            ||..:...|:       :..||.|.:.:.  |.|...|..|:|  |::.:..|.|....:.|:::
  Fly   402 KAQRQILESVEWLDAETRAEALSKEAGITPVIGSYKNEELSDT--LIREINNLTIVEGSYAQSLI 464

  Fly   552 EIYKKNKLEPNDISLNGGSHDAWAYPIVSTI------FYDTLSHSIVVPLSVILIPYFNAVLPPY 610
            .:............|:.........|:...:      ||..|.:|:.|...|:..|.::...|..
  Fly   465 NLRVLGTYLHRYAGLHADELPKDTKPLTLLVGMQVNAFYYNLDNSVYVMAGVLHPPAYHRSWPDS 529

  Fly   611 LHYASVGVSIAKEILRSIT---KSFD-----------------EKAMRC---------VPH-SVN 645
            |.:.::|..|..|:.....   .|||                 ::..:|         :|. :..
  Fly   530 LKFGTIGYLIGHELTHGFDTEGSSFDSAGEVRDWWSRKSEAVFQERAQCYVDYFNQYLIPEINQT 594

  Fly   646 IFSNYSRMDILIHSGGMQISYHSMLSLTGPIKGMARL-----------------PGLNLTPTQIF 693
            |..|.:|.:.:..:||::      .:|||....|.:|                 |||:|:|.|:|
  Fly   595 IRGNETRDENIADAGGLR------AALTGYRNHMKQLQRSGADGETLAHKNEQMPGLDLSPEQLF 653

  Fly   694 FLVSAQELCAE---SNYLGIDTNAPEFD--NILGWLVAQGGSATEVFKCPSGSMINVQ-KTCNV 751
            |:..||..||:   .:|....|.|...|  .:|| .|:......||:|||.||.::.: ::|.:
  Fly   654 FVGFAQLWCADYEPEHYWEELTGAHTVDKYRVLG-AVSNNDDFAEVYKCPLGSPMHPKAESCRM 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 147/702 (21%)
Nep7NP_651603.1 PepO 60..717 CDD:226118 149/713 (21%)
M13 66..715 CDD:189000 148/704 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.