DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep5

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_733186.2 Gene:Nep5 FlyBaseID:FBgn0039478 Length:882 Species:Drosophila melanogaster

Alignment Length:951 Identity:178/952 (19%)
Similarity:321/952 (34%) Gaps:328/952 (34%)


  Fly    12 RKNGVAGLGN---NGHGRNLIT-TANPSGGSSASLLQKQLSFKTPVGSKQMGKSDEIEMIDSANI 72
            |.|| :|.||   ||||:|..| :||          .|||.:: |:               |.|:
  Fly    48 RANG-SGNGNATANGHGQNSATESAN----------GKQLPYE-PI---------------SPNL 85

  Fly    73 ENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRD 137
            ....:::.:                  :..||:.:.....||..||:|..::.|           
  Fly    86 IGIQSKFRR------------------SYYHKVVLGGLLALVIILLIAIIVISL----------- 121

  Fly   138 CYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC--WRN--------TPN 192
                |.:.|.::     |....|...|:|:...::...|||.:|.:|:|  |.|        |.|
  Fly   122 ----GLKKSSSI-----CRSKECLRTAASLIYAMDEQTDPCEDFYQFTCGRWANEHPRPDSVTSN 177

  Fly   193 -------KNITNLIE---MGNSQKS---------------VDSQML----------YLFQ----- 217
                   .:|..::.   ..|..||               :|:::|          ||.:     
  Fly   178 DWFRERQAHIMRVVREFLRSNITKSEPEAVGKAKTMYRACMDTKLLDKRDLEPLINYLLRFGLPV 242

  Fly   218 ------------NKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLI 270
                        :|....:..:.:|..:|.:     |...|...|.:.|:    .|.|......|
  Fly   243 LPSALNLTLGSGSKYATEAANVKYNWLQSIV-----SIKQHLTMDLIIGF----DVFPDPFNRTI 298

  Fly   271 AKIYDLGPSPLVD----LYHDLSYG--RRPHILLII----------------------SGPSTSS 307
            .:| .|| :|..|    ..:|.|:.  |:.|...|.                      ...||..
  Fly   299 NRI-ALG-TPETDSAFPFNNDDSHKMLRKIHRKTIFMQNSDDEDDSEDDRESEEEEAAKQTSTGM 361

  Fly   308 T--------ILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKD 364
            |        ::|:.:.::.|.........|:.:|            |....||:.|  :.||.::
  Fly   362 TAYLHYVRKVIEKYLLYVDPNVNQEEATLGITEL------------VKQGVRVARK--VHEFKEE 412

  Fly   365 LNKLQVEHSRRGFWDSTVLYNVSSLQD---------LYPVLNW---------------TLLIPQN 405
            ...:........  |..|...:..||:         ..|:  |               .:.:.||
  Fly   413 AENMTKPSKNPA--DDIVYITLQDLQNQTDKNIAPKTLPI--WVRYMELILKGTRHAGNIQMTQN 473

  Fly   406 WSGPIVVRNSD--YLK-ALEY-------------FLTKYPTRVAHNSLLLLSALQILPRDYP--- 451
            .:  |:...:|  ||: .:||             ||:.....|.|.|    |::::|..:|.   
  Fly   474 LT--IITSQADITYLQNIVEYLDDTPASHIESYLFLSTIEELVLHTS----SSMRLLHSEYMRVA 532

  Fly   452 -SPEVCTRSTMWALPELSSSL-----YI---AQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSLKG 507
             ..|..|..:::....::|.|     |:   |..:.|.|....:....|.:|....:|....:..
  Fly   533 IGTEGSTPRSLYCANGVNSLLGMAVSYVLADADFTKEKLPKVERMLSDIRRSFDRLVKSTSWMDA 597

  Fly   508 AALVKLSALKIQSQTWEGF----SNTTDLLKSLQPLNITSECWFQNILEIY------KKNKLE-P 561
            |...|......:.:::.||    .|.:.|....:...:.:....:|:::..      |.|::: |
  Fly   598 ATKRKTIQKSAEMKSFIGFPPWLRNASVLNAYYEGAEVNASTHLENLMDFVHWQMMDKLNEMDKP 662

  Fly   562 NDISLNGGSHDAWA-YPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEIL 625
            ..|        .|| .|.....|:...|::|.||::::..|:::..|.. |:|.|:|..:..|  
  Fly   663 EPI--------GWATSPSNVNAFHTFQSNAITVPIAILQYPFYDLGLEA-LNYGSIGTILGHE-- 716

  Fly   626 RSITKSFDEKAMR------------------------CVPHSVNIFSNYSRMDI----------- 655
              :|..||:...|                        |.   |..:|.|...||           
  Fly   717 --LTHGFDDSGRRFDRAGNMVEWWSNRTIDEYVNRTECF---VEQYSRYHLADIDEYIDGELTLG 776

  Fly   656 --LIHSGGMQISYHSMLSLTGPI-KGMARLPGL-NLTPTQIFFLVSAQELC-----AESNYLGID 711
              :..:|||:.::::.......: :..::|||| :.:..|:||:......|     |.|.|...|
  Fly   777 ENIADNGGMREAFYAYRLYVKEVGRERSKLPGLEHYSHEQLFFISFGNLWCETYTPAASRYALTD 841

  Fly   712 TNAPEFDNILGWLVAQGGSATEVFKCPSGSMINV-QKTCNV 751
            ::.|....:.| :::........|||..|:.:|. |..|.:
  Fly   842 SHCPGQMRLRG-VLSNSEEFARTFKCARGTPMNPDQPKCRI 881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 143/780 (18%)
Nep5NP_733186.2 PepO 146..882 CDD:226118 144/789 (18%)
M13 151..880 CDD:189000 144/781 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.