DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and MME

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_000893.2 Gene:MME HGNCID:7154 Length:750 Species:Homo sapiens

Alignment Length:868 Identity:169/869 (19%)
Similarity:288/869 (33%) Gaps:293/869 (34%)


  Fly    58 MGKSDEIEMIDSANIENFNTRYNKNSIIGWICCAPCIWLRTSAAVHKMAITSATLLVTTLLVASP 122
            ||||:     ...:|.:.||...|.. ..|.               .:.|:.:.|::...::|..
Human     1 MGKSE-----SQMDITDINTPKPKKK-QRWT---------------PLEISLSVLVLLLTIIAVT 44

  Fly   123 ILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC- 186
            ::.|.:|         |.||           .|....|...|:.:...::...:|||:|.|::| 
Human    45 MIALYAT---------YDDG-----------ICKSSDCIKSAARLIQNMDATTEPCTDFFKYACG 89

  Fly   187 -WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILHN-------------------- 230
             |..      .|:|...:|:                .|:|.||.:                    
Human    90 GWLK------RNVIPETSSR----------------YGNFDILRDELEVVLKDVLQEPKTEDIVA 132

  Fly   231 ------LFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYDLGPSPLVD------ 283
                  |:.||:.::.        .||.||            .||:..:.|:...|:..      
Human   133 VQKAKALYRSCINESA--------IDSRGG------------EPLLKLLPDIYGWPVATENWEQK 177

  Fly   284 -----------LYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPK-APPSRIRQGVPKLLAD 336
                       ...:..||::..|.|.:.....:|  :...|....|: ..|||.......:..:
Human   178 YGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNS--VNHVIHIDQPRLGLPSRDYYECTGIYKE 240

  Fly   337 LIENFLPYFVSYA--------------QRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVS 387
            ....::.:.:|.|              |...|.:.:.|..|::.....:...|.  |..:|||..
Human   241 ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRN--DPMLLYNKM 303

  Fly   388 SLQDLYPVLNWTLLI---PQNW-----------------SGPIVVRNSDYLKALEYFLTKYPTRV 432
            :|..:..  |::|.|   |.:|                 ...:||...:||..|:..||||..|.
Human   304 TLAQIQN--NFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILTKYSARD 366

  Fly   433 AHNSL---LLLSALQILPRDYPSPEVCTRSTMWALPELSSS------------------LYI--- 473
            ..|.:   .::..:..|.|.|.......|..::.....:::                  ||:   
Human   367 LQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNMENAVGRLYVEAA 431

  Fly   474 ----AQHSSEDLKDTTKRAEIIFKSL------KAHLKRAPSLKGAALVKLSALKIQSQTWEGF-- 526
                ::|..|||  ..:..|:..::|      .|..|:....|        ||.|:.:.  |:  
Human   432 FAGESKHVVEDL--IAQIREVFIQTLDDLTWMDAETKKRAEEK--------ALAIKERI--GYPD 484

  Fly   527 ---SNTTDLLKSLQPLNITSECWFQNILEIYK-------KNKLEPNDISLNGGSHDAW-AYPIVS 580
               ||...|......||...:.:|:||::..|       |...|..|       .|.| :...|.
Human   485 DIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVD-------KDEWISGAAVV 542

  Fly   581 TIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEIL-------RSITKSFD----- 633
            ..||.:..:.||.|..::..|:|:|.....|:|..:|:.|..||.       |:..|..|     
Human   543 NAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWW 607

  Fly   634 --------EKAMRCVPHSVNIFSNYSRMDILIHSGGMQI---------------------SYHSM 669
                    ::..:|:.:.   :.|:| .|:   :||..:                     :|.:.
Human   608 TQQSASNFKEQSQCMVYQ---YGNFS-WDL---AGGQHLNGINTLGENIADNGGLGQAYRAYQNY 665

  Fly   670 LSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCA------ESNYLGIDTNAPEFDNILGWLVAQG 728
            :...|..|   .||||:|...|:|||..||..|.      ..|.:..|.::|....|:|.| ...
Human   666 IKKNGEEK---LLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRIIGTL-QNS 726

  Fly   729 GSATEVFKCPSGSMINVQKTCNV 751
            ...:|.|.|...|.:|.:|.|.|
Human   727 AEFSEAFHCRKNSYMNPEKKCRV 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 147/747 (20%)
MMENP_000893.2 Stop-transfer sequence. {ECO:0000255} 16..23 1/8 (13%)
M13 79..748 CDD:189000 148/747 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.