DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl15

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651098.2 Gene:Nepl15 FlyBaseID:FBgn0039024 Length:686 Species:Drosophila melanogaster

Alignment Length:768 Identity:151/769 (20%)
Similarity:268/769 (35%) Gaps:240/769 (31%)


  Fly   118 LVASPILFLI----STAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKD-P 177
            |:...|||.|    ::.|.||..:..:|..|.                |.|:.|:|.:...|: .
  Fly     8 LLLGAILFSICAIDASVPHPLAANYSIDILRL----------------AKAAHIKAYMGDEKEQA 56

  Fly   178 CTEFKKFSCWRNTP-------NKNITNLIEMGNSQKSVDSQMLYLFQNKIM---------NGSFG 226
            |..|..::| .|.|       :|..||.:|        :.|.||:.::..|         |.:..
  Fly    57 CNNFYNYAC-ANWPRLHPARKSKTRTNYLE--------ELQELYIRKSADMLKSATRGAENSADR 112

  Fly   227 ILHNLFESCLQQTTNS----TVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYD-----------L 276
            .|...:.||..||.::    ..:..:.|..||:..:      .:|......||           |
  Fly   113 QLKYFYGSCRLQTNDTRSALNTLQNVTDFRGGWPEI------RVASWYQYEYDWLQVVANLKRKL 171

  Fly   277 GPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWM------SPKAPPSRIR------QG 329
            |    ||::..|                  ..||:.|...|      :|:.|.||..      :|
  Fly   172 G----VDIFIGL------------------EVILDYKEEKMHRLKIGAPQFPMSRRHYLHPHFEG 214

  Fly   330 VPKLLADLIENFLP-YFVS----YAQRVSEKD-----------------TIFEFIKDLNKLQVEH 372
            ..::....|||.|. ||..    :.|.|:.:.                 |:.:..:.....:::.
  Fly   215 TREIYERSIENKLKLYFPEQSEHWRQEVASQVVQIEQQLAKGLPHNPALTLAQTTRQRTAAEMKT 279

  Fly   373 SRRGFWDST----VLYNVSSLQDLYPVLNWTLLIPQNWSGPI--VVRNSDYLKALEYFLTKYPTR 431
            :...:.|.|    :::|.:...|||..       |:::...:  |:|.:..|:...|.:.|    
  Fly   280 AYGSYVDVTRYLQLIFNDNLYMDLYET-------PEDYMSNLVDVIRETPKLQLANYTMWK---- 333

  Fly   432 VAHNSLLLLSALQI--LPRDYPSPEVCTRSTMWALPELSSSLYIAQHSS----EDLKDTTKRAEI 490
                   .|.||.|  :|....:...|.:......|....||:...::.    .:|:.|....:.
  Fly   334 -------ALEALDIARVPASQRADIWCVQLAQQFFPHQLESLFHRNYNHMQMINELQSTWSDIKR 391

  Fly   491 IFK-SLKAH---LKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNIL 551
            :|: .|:|.   |......:..|:.||.|||:..:|    .:...|::.:..|.:..:.::.|::
  Fly   392 VFREDLQASERLLWLTLETRQKAITKLEALKLHFRT----HDDNKLIRQMHGLILNMDRFYPNLV 452

  Fly   552 EIYK--------KNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYF-NAVL 607
            .:.:        |...||      ....:....|     .|:...:.|.||::.:...:| :...
  Fly   453 SVLQWKTQRGLAKLMTEP------VAEDEVHKLP-----HYEIQKNRIQVPITFLQARFFWDPAY 506

  Fly   608 PPYLHYASVGVSIAKEILR---SITKSFD-----------------EKAMRCVPHSVNIFSNYSR 652
            |..|.||::||.:|:::|.   .:.:.:|                 .:..:|......||..|..
  Fly   507 PNGLKYATLGVLLARQMLHGFDGVGRRYDAYGYKNNWWDHTSESSYSRRTQCFQEQYAIFVEYKG 571

  Fly   653 MD---------ILIHSGGMQISYHSM------LSLTGPIKGMARLPGLNLTPTQIFFLVSAQELC 702
            ..         |:..:|.:.|:|.:.      .:.|..|....|||.|:....|||:|..||..|
  Fly   572 KPVQDKDLLRRIVADNGALDIAYRAYQQWLKNAAETPVIYQRERLPLLDHDHNQIFYLGYAQLYC 636

  Fly   703 AE-----------SNYLGIDT---NAPEFDNILGWLVAQGGSATEV----FKC 737
            .:           ...|.::|   |:.:|.|      |.|.|..|.    |||
  Fly   637 TDYPETVERFDELPEQLRVNTALSNSQQFAN------AYGCSREEKLNARFKC 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 136/707 (19%)
Nepl15NP_651098.2 M13 57..684 CDD:189000 136/704 (19%)
PepO 57..677 CDD:226118 133/696 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.