DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl14

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651097.1 Gene:Nepl14 FlyBaseID:FBgn0039023 Length:696 Species:Drosophila melanogaster

Alignment Length:769 Identity:167/770 (22%)
Similarity:274/770 (36%) Gaps:247/770 (32%)


  Fly   134 LPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC--WRN--TPNKN 194
            |.::..:.|:...|......:....:..:.|..:.:.:|.:.|||.:|..::|  |::  ||.:.
  Fly    19 LQQNALVSGEDLPPPFQRIYQSEQTVRRSKAQDMGSHVNKSIDPCVDFYAYACGNWKSTLTPQQQ 83

  Fly   195 ITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILH---NLFESCLQQTTNSTVMHRIF-----DS 251
            :         |:..|.::|.|.:..:......|:.   .||:||:....:.:...:.|     :.
  Fly    84 L---------QQQTDRELLLLVEEAVRREDSVIVRQAKELFKSCVSAQAHQSQQQQHFLSEFINQ 139

  Fly   252 LGGYLPVGSVGPSS-----------IAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPST 305
            .||:..|    |.|           ::.|.......|...|:.|....:||......|.:|.|||
  Fly   140 NGGFPAV----PGSQWAVHHHDYNWLSVLGGLRLRYGMDILIGLRVGYNYGNVNENSLYLSEPST 200

  Fly   306 -SSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQ 369
             ..|.|..:.|        |.||..:.:.|...:.:.|..:::...     |.......|:  |.
  Fly   201 LIPTELCTRNR--------SDIRDSIYEPLEHRVASELKSWLALGH-----DESARLAADI--LS 250

  Fly   370 VEHSRRG--------FWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPI------VVRNS----- 415
            .||...|        .||:.        :.|| :.|:|....:.:|..|      .||.|     
  Fly   251 FEHELCGGMKGGSFESWDAE--------EQLY-LANYTRKTLREFSNSIELDLDSYVRASFGQDI 306

  Fly   416 ---DYLKALEYFLTKYPTRVAHNSLLL--------LSALQILPRDYPS--PEVCTRSTMWALPEL 467
               .|:.|.|||.....|..|||..|:        :|||.....|.|.  ...|...|...||..
  Fly   307 YKPVYMAAPEYFRQLKRTVSAHNISLVANYIMYRAVSALNFPLDDRPQLRKRECLERTKELLPTA 371

  Fly   468 SSSLYIAQHSSED-------LKDTTKRAEIIFKSLKAHLKRAPSLKGAALV---KLSALKIQSQT 522
            ...||..|..:||       |.||.|.|      |:..|.....::|...|   ||..||:|..|
  Fly   372 LGELYARQFGTEDGRIDLDNLYDTLKTA------LRQSLGAEWLVEGTQRVGQEKLRNLKLQMPT 430

  Fly   523 WEGFSNTTDLLKSLQPLNITSECWFQN------ILEIYKKNKL------EPNDISLNGGSHDAWA 575
            :|    ...:||    |.:....::||      :::..:.|:|      .|.|            
  Fly   431 YE----RPVILK----LQLERGNYWQNLRQLLGVVQSQRNNRLFEEFLPAPTD------------ 475

  Fly   576 YPIVSTIFYDT------LSHSIVVPLSVILIPYFNAVLPPYLH---YASVGVSIAKEILRSITKS 631
             |:.:   |:.      :...:.:.|:::..|.::   |.|.|   ||::||.:|::::    .:
  Fly   476 -PVEA---YEARVRLRPVQRRLDMGLALLQPPAYD---PRYGHAIRYATLGVQLAQQLV----MA 529

  Fly   632 FDEKAMRCVPH-SV--------------------NIFS----NYSRMDI------LIHSGGMQIS 665
            ||:      || ||                    |.|:    ||.|.::      :..|..:.::
  Fly   530 FDD------PHWSVGLLERDNWDGQTAWQYHIRSNCFARQVDNYLRPNVSATTQLITDSAAINVA 588

  Fly   666 YHSMLSLTG---PIKGMAR-----LPGLNLTPTQIFFLVSAQELC-------------------- 702
            :.:.|:..|   |.....:     ||.||.:.|.:|||..|||.|                    
  Fly   589 FRAYLTWLGFQEPNNDFTKLTKETLPDLNYSNTALFFLAYAQEHCSLEEARPRDEQGTPEGYLYS 653

  Fly   703 AESNYL-------GIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
            |..|:.       |...|:.||             |:| |:||.||.:|....|
  Fly   654 ARQNHTWTRLLVNGPLRNSVEF-------------ASE-FRCPIGSPMNPASKC 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 161/726 (22%)
Nepl14NP_651097.1 M13 60..693 CDD:189000 161/727 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.