DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl13

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_651096.1 Gene:Nepl13 FlyBaseID:FBgn0039022 Length:741 Species:Drosophila melanogaster

Alignment Length:739 Identity:142/740 (19%)
Similarity:265/740 (36%) Gaps:200/740 (27%)


  Fly   161 EAVASSIQARLNWNKDPCTEFKKFSC--WRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIM-- 221
            :.:|:.:|..:|.:.||||:|.:::|  | ...:|......|:..:|:.:::::....|..:.  
  Fly    54 QKIATDVQKYMNLSADPCTDFFEYACGQW-GRYHKRQLRPDELSTAQQLMETKISEQLQQLLTQP 117

  Fly   222 -------NGSFGI-------LHNLFESCLQQTTNSTVMHR----IFDSLGGYLPVGSVGPSS--- 265
                   ||..|.       :...:|||:....|::...|    |....||...|    |:|   
  Fly   118 LPPQHHPNGYSGASMTNVRKVRAFYESCVAVEANASERRRFLMKILKDNGGLRNV----PNSNWQ 178

  Fly   266 -----IAPLIAKIYDLGPSPLVDLYHDLS---------YGRRPHILLIISGPSTSSTILERKIRW 316
                 :..|.....:.|...|:.|..||:         |...|.:.:|   |:.....|..:   
  Fly   179 HNRQWVQTLGELRRNYGLDILLGLEIDLNLQTMKGNTIYFGEPKLTII---PAEHCNALATR--- 237

  Fly   317 MSPKAPPSRIRQGVPKLLADLI-ENFLPYF---VSYAQRVSEKDTI---FEFIKDLNKLQVEHSR 374
                  .:::|..|.:|:...: ||...:|   ...|.|.: .|.|   ||..|.:.:..::...
  Fly   238 ------GAQVRDEVYELVQQQVTENLRDWFGMDTGEAARFA-GDIIRFEFELCKQMGEQDIQKPE 295

  Fly   375 RGFWDS--TVLYNVSS-------------------LQDLYPVLNWTLLI----PQNWSGPIVVRN 414
            ..|..:  ..:|...|                   ..::...|::.:|:    ...:...:.:|:
  Fly   296 EEFPPAIQAQIYGARSRTGQERLRRQKGGMTLTELTSEMGNHLDFKMLVEVILESQYPSQVYLRS 360

  Fly   415 SDYLKALEYFLTKYPTRVAHNSLLLLSALQIL---PRDYPSPEV--CTRSTMWALPELSSSLYIA 474
            .:|:|.: ....|...|:.....:|..||..|   |.:.||...  |.:.|....|::...:: .
  Fly   361 PEYVKHV-VRTVKANNRITVGGYILYVALNELNQPPEEAPSQRARQCVQVTQRLFPQVLGEMF-Q 423

  Fly   475 QHSSED---------LKDTTKRAEIIFKSLKAHLK-RAPSLKGAALVKLSALKIQSQTWEGFSNT 529
            :|...|         ..|..|..|..|     |:: ...:.:.||..:||..::.          
  Fly   424 RHVQRDNAKHDLDAVFNDVIKALEEQF-----HVEWMDENDRRAARTRLSQYRVS---------- 473

  Fly   530 TDLLKSLQPLNIT------SECWFQNILEI---YKKNK----LEPNDISLNGGSHDAWAYPIVST 581
               |...|.|::|      ||.:::. |||   |:.::    |..||...:....|  |:.:.:.
  Fly   474 ---LPDYQSLDLTDLQFQKSEDYWRR-LEIALKYRSHQQFEALRGNDFGQDADGLD--AFEVRAA 532

  Fly   582 IFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRS------------------I 628
            :  ......::|...::..||:|...|..|.||.:|..:|..::::                  :
  Fly   533 L--SPRQQMVLVGWGLLQAPYYNYYYPKSLKYALLGHRLASALVQAFDDEGWNNHPQATAQWNEV 595

  Fly   629 TKSFDEKAMRC--------VPHSVNIFSNYSRM-DILIHSGGMQISYHSMLS-------LTGPIK 677
            |.|....|..|        :.:....|.|.:|: :|:....|:.:::::.|:       ...|:.
  Fly   596 TMSGYRNASECQRAQYSSYLYNEPGEFRNATRLREIIADGSGLNLAFNAYLAWLEQQDHKLRPLL 660

  Fly   678 GMARLPGLNLTPTQIFFLVSAQELC-AESNYLGI--------------DTNAPEFDNILGWLVAQ 727
            ....|..||.|.||:||:..||..| |:.|...|              |.|.|         ::.
  Fly   661 AKETLSELNFTNTQLFFIYFAQTRCWAKDNQDAILDSMPLMQHTPERWDVNGP---------LSN 716

  Fly   728 GGSATEVFKCPSGSMINVQKTCNV 751
            .......|.|..|:.:|....|.|
  Fly   717 SAEFGREFGCALGTPMNSGDKCLV 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 137/721 (19%)
Nepl13NP_651096.1 PepO 63..732 CDD:226118 137/721 (19%)
M13 68..738 CDD:189000 137/722 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.