DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep4

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_650904.3 Gene:Nep4 FlyBaseID:FBgn0038818 Length:1040 Species:Drosophila melanogaster

Alignment Length:933 Identity:174/934 (19%)
Similarity:290/934 (31%) Gaps:356/934 (38%)


  Fly   116 TLLVASPILFLISTAPSPLPRDC-----------------------YMDGDRCSP---------- 147
            ||:..|...||    |..:||:|                       |.|   .:|          
  Fly   166 TLMKDSRTSFL----PLGIPRECLGSGIELDIKPIDEEAYQRQKKRYQD---IAPYWLEKIRIRE 223

  Fly   148 ---AVSAPPECSDPICEAVASSIQARLNWNK-----------------------DPCTEFKKFSC 186
               |.....|.|..|.||.| ::|:  .||:                       |||.:|.|::|
  Fly   224 RREAERHAEEASAEISEATA-ALQS--FWNEEGTREGIRMTQAKTMKRYMDNKVDPCVDFYKYAC 285

  Fly   187 --W--------------------------------RNTP------------NKNITNLIEMGNSQ 205
              |                                :|||            ...:..|.|.|..:
  Fly   286 GNWERLHPIPKDKAGFDTFEMLRESLDLVLRNLLEKNTPVHSAAELRKSPVRNTLFKLNEQGEGE 350

  Fly   206 KSVDS-----------------QMLYLFQNKIM-------NGSFGILHNLFESCLQQT------- 239
            ...|.                 |:|    |:::       ||:  ....|.|:..::|       
  Fly   351 GEADQAAELTAERLRRHIVSKRQLL----NRVLVRYKRYTNGT--KRKRLIETPRERTKEEEAAP 409

  Fly   240 -------------TNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAK-----------IYDLGPSP 280
                         .|...:|         :|...:.|...|.|.||           :...|..|
  Fly   410 PVVLPKDKTKDKSDNEEQLH---------VPTDFLKPHQDAQLKAKNLYRSCVNSAVLAKRGLEP 465

  Fly   281 LVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSR------IRQGVPKLLADLIE 339
            |..|..:|.           ..|...|...|....|....|...|      |.|.|...:.:..|
  Fly   466 LHTLIRELG-----------GWPVLESQWSESNFNWQVLAATLRRYNNDILIVQWVGADIKNSEE 519

  Fly   340 NF---------LP------------YFVSY-----------------AQRVSEKDTIFEFIKDLN 366
            |.         ||            |..:|                 ||||:.:...||  ..|.
  Fly   520 NIVQFDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMHKMGASKADAQRVASELVAFE--TQLA 582

  Fly   367 KLQVEHSRRGFWDSTVLY---NVSSLQDLYPVLNWTLLIPQ------NWSGPIVVRNSDYLKALE 422
            .:.....:|  .:.|.||   .:..||.:.|.:.|...:..      ..:..:|:...:|:..|.
  Fly   583 GITAPAEQR--LNVTKLYKRMTLDQLQAVVPEIKWRAYLQSLQDREVLGTEEVVIYAVEYMSKLV 645

  Fly   423 YFLTKYPTRVAHNSLL------------------------LLSALQILPRDYPSPEVCTRSTMWA 463
            ..|.:...|...|.::                        .|...:..|:.:   :||.......
  Fly   646 TLLDETDPRTVSNYMMWRFVRHRINNVDDRFDDIKQSFYHALFGREESPQRW---KVCIAQVNTN 707

  Fly   464 LPELSSSLYIAQHSSEDLK-DTTKRAEIIFKSLKAHLKRAPSL----KGAALVKLSALKIQSQTW 523
            :.....|::::::...:.| ||.:....:.::.:..||....|    |..|..|::|:.::....
  Fly   708 MGMAVGSMFVSRYFDNNSKRDTLRMTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYP 772

  Fly   524 EGFSNTTDLLKSLQPLNITSECWFQNILEIY------KKNKLEPNDISLNGGSHDAW-AYPIVST 581
            :...|.::|......:.|..|.:|:|.|.:.      ::.||.......|      | ..|.:..
  Fly   773 DFILNPSELNSKYAGIEIYPEKYFENTLNVLLHTAKTEQAKLHERVNKTN------WQTAPAIVN 831

  Fly   582 IFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILR-------------------- 626
            .:|....:.|:.|..::..|:::...|..|::..:||.|..|:..                    
  Fly   832 AYYSRNKNQIMFPAGILQPPFYHRHFPKSLNFGGIGVVIGHELTHGFDDKGRLFDRNGNIHKWWT 896

  Fly   627 -SITKSFDEKAMRCVPHSVNIFSNYSRMDI-------------LIHSGGMQISYHSM-------- 669
             |..:.|||:| ||:   :..:|||:..::             :..:||::.::|:.        
  Fly   897 DSSIRGFDERA-RCI---IAQYSNYTVEEVGIVLNGESTQGENIADNGGLRQAFHAYQRWLKEHP 957

  Fly   670 LSLTGPIKGMARLPGLNLTPTQIFFLVSAQELC------AESNYLGIDTNAPEFDNILGWLVAQG 728
            ..::..|     |||||:|..|:|||...|..|      |..|.|....::|....::|.|....
  Fly   958 SEVSDEI-----LPGLNMTGPQLFFLNFGQVWCGAMRPEAIRNKLNTAIHSPGRFRVIGTLSNSV 1017

  Fly   729 GSATEVFKCPSGSMINVQKTCNV 751
            ..|.| |.||.||.:|.||.|:|
  Fly  1018 DFARE-FNCPLGSPMNPQKKCSV 1039

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 150/811 (18%)
Nep4NP_650904.3 M13 274..1038 CDD:189000 151/813 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.