DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl12

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_649924.1 Gene:Nepl12 FlyBaseID:FBgn0037727 Length:702 Species:Drosophila melanogaster

Alignment Length:722 Identity:145/723 (20%)
Similarity:269/723 (37%) Gaps:211/723 (29%)


  Fly   164 ASSIQARLNWNKDPCTEFKKFSC--WRNT-PNK----NITNLIEMGNSQKSVDSQML---YLFQN 218
            |..:::.:|.:.:||..|.:::|  :||. |::    :.:||.::..:...:..|:|   .|.:.
  Fly    57 AEFMKSYMNQSVEPCENFYEYACGNYRNVKPDRYSPGSRSNLGDVTYTLIDITEQLLGRMDLAEA 121

  Fly   219 KIMNGSFGILHNLFESCLQQTTNSTVMH----------RIFDSLGGYLPV-GSVGPSSIAPLI-- 270
            ..::....:....:.:||     ...:|          .:..|:||:..| |....:|....|  
  Fly   122 LNVSSELAVAQRFYNACL-----GANLHPFNAADPAYLSLIRSIGGFPAVDGDAWKASNFNWINM 181

  Fly   271 -AKIYDLGPSPLVDLYHDLSYGRRP----------HILLIISGPSTSSTILERKIRWMSPK---- 320
             |.:.:.|.:.|:.....|.|...|          ||::.....|.::|   |..|....:    
  Fly   182 SAHLANYGANGLIRETLQLRYPFEPYTKLPELGFDHIIVHEENISRNTT---RAFRLNEERMHGY 243

  Fly   321 -----APPSRIRQGVPKLLA---DLI------ENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVE 371
                 .|..|||:.:..:.|   |.:      |.|.||.:                         
  Fly   244 LRAFGLPEDRIREAIAGVFAFWRDALEIPPQCEVFDPYRI------------------------- 283

  Fly   372 HSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSD------YLKALEYFLTKYPT 430
              :|.|..|...||:|                  |||   :.:::      |...|:....::..
  Fly   284 --KRVFPQSEYYYNIS------------------WSG---LHSTNKLFCDFYYVELDKVCARHRK 325

  Fly   431 RVAHNSLLLLSALQILPRDYPSPEV-------CTRSTMWALPELSSSLYIAQHSSEDLKDTTKRA 488
            .|| |.|    |:::|.|..|..:.       |:.:...::..|.:.||:|.:.||     .||.
  Fly   326 AVA-NYL----AMKLLYRFDPKLKAPRYQRNYCSVTLYQSMRFLFNKLYMANNFSE-----AKRL 380

  Fly   489 EI------IFKSLKAHLKRAPSL----KGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITS 543
            |:      :.|||:..|:.|..|    :..||:|.|.::.:..:::..:.:..:::.:..|.:..
  Fly   381 EMSEMVRELRKSLRKALEDADWLDAESRARALLKESRIQPRIGSFQDDALSDRIIREINSLKVIE 445

  Fly   544 ECWFQN-------ILEIYK---------KNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIV 592
            :.:.:.       :::|.:         .|..:|..| |.|....|..|         |..:||.
  Fly   446 DRYAETNINLQHLVVQINRFSSRHFQELTNDTKPQKI-LTGLQVGAGYY---------TPDNSIN 500

  Fly   593 VPLSVILIPYFNAVLPPYLHYASVGVSIAKEI----------------LRSITKSFDEKAM---- 637
            |...|:..|.:...||..|.:.::|..:..|:                :.|:.....::|:    
  Fly   501 VMAGVVEPPIYQRHLPISLKFGTLGFIVGHELIHGFDTTSSYFDGNGHMESLLSEISQQALEDRA 565

  Fly   638 RC---------VPHSVNIFSNYSRMD--ILIHSGGMQ--ISYHS----MLSLTGPIKGMARLPGL 685
            .|         ||......:..:.:|  |..:||..|  .:|.|    :|...|..:....:|||
  Fly   566 ECYMDYYGKYQVPEISRRVNGKTTLDENIADNSGLRQALTAYRSHRQQLLEHPGQERISDAMPGL 630

  Fly   686 NLTPTQIFFLVSAQELCA---ESNYLGIDTNAPEFD--NILGWLVAQGGSATEVFKCPSGS-MIN 744
            :|||.|:|||..||..|:   |.:|....::...||  .:|| :::........:.|..|| |..
  Fly   631 DLTPEQLFFLGFAQLFCSHYEEEHYWKGLSDVHTFDQFRVLG-VLSNSEDFFHAYNCSVGSGMRP 694

  Fly   745 VQKTCNV 751
            ..|||.:
  Fly   695 GAKTCRL 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 142/707 (20%)
Nepl12NP_649924.1 M13 68..700 CDD:189000 143/709 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.