DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl11

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster

Alignment Length:688 Identity:128/689 (19%)
Similarity:231/689 (34%) Gaps:230/689 (33%)


  Fly   166 SIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQ-----KSVDSQMLYLFQNKIMNGSF 225
            :::..|:.:|.||.:|..:.|      .:..||.|.|..:     |..|...|...:.:::    
  Fly    34 NLEPYLDTSKQPCQDFYGYVC------SHSANLSETGRQRFQSLLKETDVAQLMDMELQLI---- 88

  Fly   226 GILHNLFESC-----LQQTTNSTVMHRIFDSLGGYLPVGSVGPSSI------------APLIAKI 273
                |.|:||     ::....|    :::...||:   .|:.|:.:            ..|:...
  Fly    89 ----NFFKSCESGRGVEALKGS----QLYRQSGGW---PSLEPNKVNASQRTNQTQRWLGLLGYF 142

  Fly   274 YDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLI 338
            :::|.....:....:...:|   |:::....|....|.:                          
  Fly   143 HEVGAPYFFETSVTMQSNKR---LVVLQPDGTRRNTLRK-------------------------- 178

  Fly   339 ENFLPYFVSYAQRVSEKDTIF------EFIKDLNKLQVEHSRR----------------GFWDST 381
                     :.|||.|....|      ..:..|..|.:|.|||                |.:...
  Fly   179 ---------FEQRVGEVLQSFGIEQSRAHVTALEVLSLERSRRDIVKADHVEDQVQFSYGNFKRI 234

  Fly   382 VLYNVSSLQDLYPVLNW-----TLL---IPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLL 438
            |..|.|.::     |:|     .||   .||. |..|||:....|  :|||     ..:.:.|::
  Fly   235 VFGNASLIR-----LDWDGYFRKLLGGKTPQA-SDTIVVKQLPRL--VEYF-----ALLQNTSMV 286

  Fly   439 LLSALQILPRDYPSPEV---CTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEI--IFKSL-KA 497
            .|  |..:..||....|   |.:.:.....:|.:  ::.|      :.|..|.|:  ::..| ||
  Fly   287 RL--LNWIWTDYLMDIVDADCHQLSETYAGDLYA--HVVQ------RVTANRVELAQMYSELGKA 341

  Fly   498 HLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNIL----EIYKK-N 557
            :   ...|.|:..:...:.:...|......:||  |...:.|:..    :.:||    .:|:. .
  Fly   342 Y---TDQLGGSVWIDEISRQSSRQFLGNIMHTT--LNGDERLDAA----YHSILLGRRSLYRNLE 397

  Fly   558 KLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAK 622
            ||.....:....||.|......:.:|         .|::..|..: |...|  |:|..:|...::
  Fly   398 KLRKFQRTRRLASHSAQQVRRYAQMF---------APVNAFLGQH-NLSTP--LNYLLLGEFFSR 450

  Fly   623 EILRSITKSFDEKAMR-------------CVPHSVNIFSNYSRMDILIHSGGMQISYHSMLSLTG 674
            .::.:.:.|..:.|.|             ||....|      .:|:|:    ..::....||..|
  Fly   451 SLVAAGSSSRTQGAWRSSDSERRFAIFQQCVGKQTN------AIDLLL----SLLAQRQALSAYG 505

  Fly   675 PIKGMARLPGL-------------NLTPTQIFFLVSAQELC-AESNYLGID----------TNAP 715
              :.:|...||             .::..::||:.|....| :|...|..|          .|:|
  Fly   506 --QWLATQAGLVERVDAVLAAGSSKMSLQRLFFVTSLLVDCRSELGALQQDRKRQVTHATLRNSP 568

  Fly   716 EFDNILGWLVAQGGSATEVFKCPSGSMINVQ-KTCNVL 752
            ||              .|.|:|..|.::..| :.||.|
  Fly   569 EF--------------LEAFRCRPGDVLYPQDQRCNPL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 123/674 (18%)
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 123/673 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.