DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and phex

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001307259.1 Gene:phex ZFINID:ZDB-GENE-030103-2 Length:745 Species:Danio rerio

Alignment Length:820 Identity:147/821 (18%)
Similarity:272/821 (33%) Gaps:252/821 (31%)


  Fly    98 TSAAVHKMAITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEA 162
            |.|:.....:..|.|.|...:..:.::.:|:.:......|.                |..|.|..
Zfish    11 TKASAGPNTLLKAALAVCVCVCIALLIAVITVSQKASNEDL----------------CLGPHCVE 59

  Fly   163 VASSIQARLNWNKDPCTEFKKFSC--W-RNTPNKNITNLIEMGNS-------QKSVDSQMLYLFQ 217
            .|.||.::::.:.|||.:|.:::|  | |..|      :.|..:|       :::||.::..|.:
Zfish    60 AAGSILSKMDQSVDPCDDFYQYACGGWLRENP------IPEDSSSYGIYPWLRQNVDLKLKELLE 118

  Fly   218 NKIMNGSFGILHN---LFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIYD---- 275
            ..:.:|....:..   |:.||:.::.               |.:....     ||:..:..    
Zfish   119 QPVRSGDIEAVKKAKVLYASCMNESA---------------LEIEDAN-----PLLKNLKQKEFR 163

  Fly   276 -------LGPS-----PLVDLYHDLSYGRRPH----ILLIISGP------------STSSTILER 312
                   ||.|     ...:|...|:..|..|    ::.:...|            ..:|..|..
Zfish   164 WPVLGDALGSSSRWVESQFNLLETLAQIRSQHSKSVLIRLFVAPDDKNSNQYIIKLDQASLSLSS 228

  Fly   313 KIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEK------DTIFEFIKDLNKLQVE 371
            :..:::........|:.:.:|:.|         ||.....||:      .::.:|...|.::.:.
Zfish   229 REDYITNTTEAQMYREALLRLMVD---------VSVMLGASEQAAEAQMKSVLDFEMKLAQIVIP 284

  Fly   372 HSRRGFWDSTVLYNVSSLQDLYPVLNW---------TLLIPQ---NWSGPIVVRNSDYLKALEYF 424
            :..|...:....|::|.||...|..||         |.|.|.   :.|..::||...|.|.|...
Zfish   285 YENRTSENMYNKYSLSKLQRTVPDFNWLGFVRAVIDTELYPDLKISSSEQVIVRAPQYFKDLFKL 349

  Fly   425 LTKYPTRVAHNSLL---LLSALQILPRDY------------------PSPEVCTRSTMWALPELS 468
            :....||...|.::   :.|.:..|.|.:                  |..:.|.......|...:
Zfish   350 INATDTRTVANYVIWRSVFSRITTLSRRFLYRYLDFARVTTGTTSLTPRWDKCVNYVENTLIYAA 414

  Fly   469 SSLYIAQHSSEDLK--------------------------DTTKRAEIIFKSLKAHLKRAPSLKG 507
            ..|::.:|..||.|                          :.|||..|.    |||         
Zfish   415 GRLFVDKHFQEDKKHMMEELINGIRWAFIDILEKENEWMDEETKRKAID----KAH--------- 466

  Fly   508 AALVKLSALKIQSQTWEGFS----NTTDLLKSLQPLNITSECWFQNILEIYKKNKLEPNDISLNG 568
            |.|.|:           |:.    |.|.:.:.::.|..|...:|.|:::..|  .:..:||    
Zfish   467 AVLPKV-----------GYPDFILNDTYINEDIKRLAFTMTDYFGNVMQTLK--FIAQSDI---- 514

  Fly   569 GSHDAW-----------AYPIVSTIFYDTLSHSIVVPLSVILIPYFNAV-LPPYLHYASVGVSIA 621
                .|           ..|.....||.:.::.|..|...:..|:|..: .|..|.|.::||.:.
Zfish   515 ----GWLRKTVPRTEWFTNPTTVNAFYSSSTNQIRFPAGELQKPFFWGLNYPRSLSYGAIGVIVG 575

  Fly   622 KEIL---------------------RSITKSFDEKAMRCVPH---------SVNIFSNYSRMDIL 656
            .|:.                     .|....|.||....:..         .:|:....:..:.:
Zfish   576 HELTHGFDNNGRKYDKDGNLDQWWSNSSINRFTEKTQCMIDQYNSYYWKEAGLNVKGKRTLAENI 640

  Fly   657 IHSGGMQISYHSMLSLTGPIKGMAR---LPGLNLTPTQIFFLVSAQELC------AESNYLGIDT 712
            ..:||::.|:.:........:|...   |||:.||..|:|||..|...|      |..:.:....
Zfish   641 ADNGGIRESFRAYRRWVEKERGGVEEPLLPGVGLTHNQLFFLSYAHVRCNAYRPEAARDQIQSGA 705

  Fly   713 NAPEFDNILGWLVAQGGSATEVFKCPSGSMIN-VQKTCNV 751
            ::|....::| .::......:.|.||..|::| ..::|.|
Zfish   706 HSPPKYRVIG-AMSNFEEFRKAFNCPETSIMNRGAESCRV 744

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 132/739 (18%)
phexNP_001307259.1 PepO 61..744 CDD:226118 136/753 (18%)
M13 72..743 CDD:189000 133/741 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.