DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl10

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_610787.1 Gene:Nepl10 FlyBaseID:FBgn0033742 Length:633 Species:Drosophila melanogaster

Alignment Length:627 Identity:119/628 (19%)
Similarity:227/628 (36%) Gaps:129/628 (21%)


  Fly   145 CSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWR-NTPNKNITNL--IEMGNSQK 206
            |..|:..|.:....|..|.::.|...||....|||.|..|:|.| ::.:|.:.|.  :|...:..
  Fly    10 CLVALFIPIQAIVDINVATSNDIHNNLNRTTSPCTNFWNFACGRFSSASKYVDNFERVEDQFATA 74

  Fly   207 SVDSQMLYLFQNKIMNGS-FGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLI 270
            .|:....:|.:|..:... ...:...:::|.:.|..   :|      |...|...|....:.|..
  Fly    75 MVEFMESHLGENDTLAPRLIKQMRQYYKACKEDTRK---LH------GNPRPEELVNQWILHPKK 130

  Fly   271 AKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLA 335
            ..:|.|. ...:|...|::.......::.:..|..:....:|::..:......:....||.||:.
  Fly   131 FLVYGLN-GVFIDERVDVAANDSMRWVIQLRMPDPADRYSDRRVLQLMRLYEEAWYSMGVVKLVE 194

  Fly   336 DL--------IENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDL 392
            .:        .|..:.|..|:::...|......|..:|  |.|.|:...:..:..:.:|..|::.
  Fly   195 KMHQLQDKYRAEYPVVYTWSFSELRQEIPIPHSFFIEL--LGVNHTEELYHLTFEVSDVEYLREC 257

  Fly   393 YPVLNWTLLIPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPEVCT 457
            :..|......|::          .|::|.:|.|.:                :..||: .:|..|.
  Fly   258 FRCLRDFASEPKD----------TYIRARQYVLVE----------------ESEPRE-RNPRSCI 295

  Fly   458 RSTMWALPELSSSLY---IAQHSSEDLKDTTKRAEIIFKSLKA---------HLKRAPSLKGAAL 510
            ......||...:.:|   |.|:..|   ||:|..||: .:|||         .|:..|:......
  Fly   296 HHMRAYLPLGMNYIYDRFIYQNREE---DTSKVLEIL-STLKAAFGQYLDANRLQLTPNQLAYVR 356

  Fly   511 VKLSALKI------QSQTWEGFSNTTDLLKSLQPLNITSECWFQNILEIYK-KNKLEPNDISLNG 568
            .||..::|      :.::.|.::|      .....|.::..:..|:||.:. :.:|:...:....
  Fly   357 AKLEGIQIKIGNLPEEKSPEFYNN------HYGSANFSATNFLANLLEAFALRTRLQNAGLLARN 415

  Fly   569 GSHDAWAYPIVSTI-------FYDTLSHSIVVPLSVILIPYFN-------------AVLPPYLHY 613
            ...|...|.:...:       ||:...::|.||:..:..|.|:             |||...:::
  Fly   416 SRVDLRHYYVNDNVRKARTSPFYENERNTITVPMEFLQWPLFDHREHTIFQHSLLGAVLGHEMNH 480

  Fly   614 A---------------SVGVSIAKEILRSITKSFDEKAMRCVPHSVNIFSNYSRMDILIHSGGMQ 663
            |               .||:.|.:      :|.|.: |::|......:    |..:.|....|:|
  Fly   481 AFEQEGILFDAAGNESPVGLEIRE------SKPFRD-AIKCAEEQPFV----SLKERLADLNGLQ 534

  Fly   664 ISYHSMLSLTGPIKGMARLP---GLNLTPTQIFFLVSAQELC 702
            ::|.:...|....:.....|   ....|..|:|.|..||..|
  Fly   535 LAYDAFFGLAHDSRQFEYRPYAFEQEFTAPQLFHLSYAQFFC 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 111/597 (19%)
Nepl10NP_610787.1 GluZincin 41..608 CDD:301352 111/597 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.