DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl9

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609815.1 Gene:Nepl9 FlyBaseID:FBgn0032613 Length:652 Species:Drosophila melanogaster

Alignment Length:718 Identity:137/719 (19%)
Similarity:226/719 (31%) Gaps:273/719 (38%)


  Fly   172 NWNKDPCTEFKKFSC--WRNTPNKNITNLI----------------EMGN---------SQKSVD 209
            |.:.|||.:|...:|  :..|..:|..:.:                |:||         ||...:
  Fly    58 NDSMDPCDDFYAHACGNFDQTKEENSDDFLPPYLYNKQDRMNFFTAEVGNFETIPGRLISQLYTE 122

  Fly   210 -------------------SQML----YLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDS 251
                               .:||    :|.::|.:..|:..|.:.:|           ..|::..
  Fly   123 CRKREERNVFTPTRLTSHWERMLDEIPFLARHKEVLSSWPFLKHQWE-----------RRRLYGQ 176

  Fly   252 LGGYLPVGSVGPSSIAPLIAKIY----DLGPSPLVDL-----------YHDLSYGRRPHILLIIS 301
            |...:....:....: |.:..||    .:..||:.:|           ..|:..||...:..|| 
  Fly   177 LNWIVLSAQLAAHGL-PTLLHIYFALDTIYVSPMEELPCPSIADFQSSLSDVLEGRHHQVSRII- 239

  Fly   302 GPSTSSTILERK-------IRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSY--AQRVSEKDT 357
              |....:|.|:       :|.:|.....:..|.|..:||.|  ||.:.||..|  |...||:..
  Fly   240 --SHEMRVLCREMRGELPLVRSLSQNTRTNTSRPGEEQLLLD--ENTMDYFQQYFAALNFSEERL 300

  Fly   358 I--FEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYLKA 420
            :  .:|..|:.|                                  |.|.|.   |:|:::    
  Fly   301 VGARKFPLDVEK----------------------------------ITQAWE---VLRHTE---- 324

  Fly   421 LEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQHSSEDLKDTT 485
                     ||:.:|.::..:..|:   .||.   |.|.:    .|....|:........|:...
  Fly   325 ---------TRIVYNYVMWQAREQL---RYPD---CYRVS----EEFERLLHAEYWQWHVLRRHL 370

  Fly   486 KRAEIIFKSLKAHLKRAPSLKGAALVK----------------LSALKIQSQTWEGFSNTTDLLK 534
            .| |:...|.:.|..|...|:.:.|.:                |...:|.....|.:.|.|:|.:
  Fly   371 SR-EVALASYQLHTTRFQKLRRSKLSRRDWYGHLWPASVEKKELQVARILQNHAENYLNITELNE 434

  Fly   535 SLQPLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPL---- 595
            :.:.|.:....::.|:|.:.:..                             |.||.|.|.    
  Fly   435 NYEGLKLEKNSFYANLLILRRAQ-----------------------------LRHSFVSPYVDEE 470

  Fly   596 -----SVILIPYFNAVL-----PPYLHYASVGVSIAKEILRSITKSFDEKAMRCVPHSVNIFSNY 650
                 :..|..:.:.||     |.|.:||:.|:.:.:|....:.......||.|:..  ..|.:|
  Fly   471 DVNQPAYFLRHFLHFVLLSLHRPTYHYYATHGLELWRESRLLLDTDGHYTAMDCLER--QSFQHY 533

  Fly   651 SRMDILIHS--GGMQIS---------------YHSMLSLTGPIKGMAR---LPGLNLTPTQIFFL 695
            ......|:.  |..:|:               ||..|.  |.....|.   |....|.|.::.|.
  Fly   534 DAKLAPIYRPLGSHEIAEIFQFYRSFQYSLTDYHFWLQ--GERFAFAETFVLDYFGLNPHRVLFY 596

  Fly   696 VSAQELC--------AESN--YLGIDTNAPEFDNILGWLVAQGGSATEVFKC--------PSGSM 742
            ..||:||        |:.|  |:    |.|||.              |.|||        ||..|
  Fly   597 AVAQQLCNRQTEIFAAQLNRGYM----NLPEFQ--------------EAFKCGAEKAMNPPSRCM 643

  Fly   743 INV 745
            ||:
  Fly   644 INM 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 136/715 (19%)
Nepl9NP_609815.1 GluZincin 62..>84 CDD:301352 7/22 (32%)
GluZincin <579..642 CDD:301352 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.