DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl8

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609795.2 Gene:Nepl8 FlyBaseID:FBgn0032585 Length:619 Species:Drosophila melanogaster

Alignment Length:708 Identity:131/709 (18%)
Similarity:222/709 (31%) Gaps:300/709 (42%)


  Fly   163 VASSIQARL--------NWNKDPCTEFKKFSCWR------------------NTPNKNITNL--- 198
            ||:|...||        :...:||..:...:|.:                  :..|:|:..|   
  Fly    12 VAASSNTRLLNGILSHVDKEANPCENYYNHACGQYNMRHIDDTFFDIIQMLDHQVNQNLVKLMDE 76

  Fly   199 IEMGN-----SQKSVDSQML--YLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYL 256
            :||.:     :..|||.::|  ||                  ||.....|       .|||..||
  Fly    77 LEMSSQLPDFNVSSVDGKVLRYYL------------------SCRGAPRN-------MDSLSQYL 116

  Fly   257 PVGSVGPSSIAP------------------LIAKIYDLGPSPLVDLYHDLSYGRRPH-------- 295
            .|.|.|.....|                  .:|.::..|   |.:::.:|.....|.        
  Fly   117 KVISPGEGLTWPQFIPDGSSWPQENFKWLKALAHLHRYG---LTNVFFNLEVVSNPRNASEYMVE 178

  Fly   296 ---------------------ILLIISGPSTSSTILERKIR------------------------ 315
                                 :|.||..||:....|.||:|                        
  Fly   179 LNTPTFGEESQLPNSFIEILSVLYIIKVPSSEIITLARKMRTLELLLKTMINPIDTLNNRYISIR 243

  Fly   316 ---------WM--------SPKAPPSRIRQGVPKLLADLIENFLPYFVSYAQRVSEKD------- 356
                     |.        |..||..::          |:.|| .||.:..:.:.::|       
  Fly   244 DFQMETGHNWQRFFEILIGSSAAPELQV----------LVRNF-RYFTALKELMDKQDARLVASY 297

  Fly   357 -----TIF------------EFIKDLNK-----LQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWT 399
                 .||            |.:..:.:     ..:.:..|.|.|||...|:..::|::..|...
  Fly   298 IMTRFAIFLLDETMGGRESTECVSQVRRNMNLAANMLYKERFFEDSTFSANILEIKDIFEKLRHQ 362

  Fly   400 LLIPQNWSGPIVVRNSDYLKALE--YFLTKYPTRVAHNSLLLLSALQILPRDYPSPEVCTRSTMW 462
            .|:.       |.:|...|.||:  :|:.|            ..|::|              .:.
  Fly   363 FLLQ-------VDQNHLELTALQMKFFVRK------------AEAIEI--------------NVV 394

  Fly   463 ALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFS 527
            .||:.....:......:||:..|  .|:.:.  :.|||         :::....|:.:|:.:|.|
  Fly   395 NLPKTDDLRHFIGQYYQDLQFPT--GELDYH--QEHLK---------VLQFRTQKMLAQSSKGHS 446

  Fly   528 NTTDLLKSLQPLNITSECWFQNILEIYKKN--KLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHS 590
            ..                  |||| .|:..  .|.|........|.|.:.|.::..|    ::|.
  Fly   447 EE------------------QNIL-TYRSQAAPLPPPQPFFQLESEDVFKYSLMGYI----MAHH 488

  Fly   591 IVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITKSFD----EKAMRCVP-HSVNIFSNY 650
            ::..                  :|:.|::|..:   ...:||.    |:|:.|:. :|.||  :.
  Fly   489 LISA------------------FATEGITIGSD---GNDQSFRSHRFEEAVSCLSRNSENI--DE 530

  Fly   651 SRMDILIHSGGMQISYHSMLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCAESNYL 708
            |..||    .|::::|.:...:.   |...||...:|.|.|||||...|..|..|:.|
  Fly   531 SMGDI----AGLELAYFTYAKMA---KNRNRLDFTHLPPEQIFFLNVGQFFCGNSDML 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 126/688 (18%)
Nepl8NP_609795.2 GluZincin 32..618 CDD:301352 126/689 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.