DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl7

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001285879.1 Gene:Nepl7 FlyBaseID:FBgn0032442 Length:669 Species:Drosophila melanogaster

Alignment Length:731 Identity:149/732 (20%)
Similarity:256/732 (35%) Gaps:216/732 (30%)


  Fly   150 SAPPECS--DPICEAVASSIQARLNWNKDPCTEFKKFSC--WRNTP-------NKNITNLIEMGN 203
            |.||..:  :.:.|.....:.:.:|...|||..|.:|||  |:...       |.:..|.|    
  Fly    25 SLPPATNHREEMLEDYGRFLLSTMNRTIDPCENFYEFSCGGWKKADLVPEQARNTSFLNAI---- 85

  Fly   204 SQKSVDSQMLYLFQNKI--------MNGSFGI---LHNLFESCLQQTTNSTVMHRIFDSLGG--- 254
             |..:|.|:....||..        :||:...   ....:.||::...|.::.::.|....|   
  Fly    86 -QHKIDEQIQGFLQNATKRELEDLGVNGTTSAEIKAKQFYASCVEMKANLSLGYQYFMEHDGDRL 149

  Fly   255 --------YLPVGSVGPSSIAPLIA-KIYDLGPSPLVDLYHDLSYGRRPHILLIISGPST----- 305
                    ::.:..:....|.||:| |:            |..:..|:..|||.:  ||.     
  Fly   150 KERNATYDWMYINFMSKYDIYPLLALKV------------HYSTSSRKFDILLTL--PSKVLAGF 200

  Fly   306 SSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENF--LPYF----VSYAQRVSEKDTI--FEFI 362
            |...|:...|.....:...:::|        .:|||  |..|    ||.|:..:|.:.:  .||:
  Fly   201 SEEQLKNMTREFGLDSSAEKVKQ--------FVENFNNLTQFERNLVSLAKSRNETEQLNFKEFL 257

  Fly   363 -----KDLN-----KLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSDY 417
                 ..||     :|....|:...|  .||..:.::.||...|..|.|  :...|.|.:|  :.
  Fly   258 VKHKHDRLNWTRFFELAFNGSQESHW--PVLNQLDNINDLVFFLEQTNL--ETLKGYIKMR--EL 316

  Fly   418 LKALEYFLTKYPTRVAHNSLLLLSA----LQILPRDYPSPEVCTRSTMWALPEL------SSSLY 472
            :|....:.|:..|....:....||.    ..:||              |.:.::      :..|.
  Fly   317 VKFYGLWKTQTKTGGVQSECRSLSETYFNYALLP--------------WFIGKVFDKERRADILS 367

  Fly   473 IAQHSSEDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQ 537
            :|    :|:|||      .:..|..|.......:..|..||:::.|       ....||.|:..:
  Fly   368 VA----KDIKDT------FYDLLDHHTWLDEDTRSQAKTKLASMDI-------LVGYTDDLQHRE 415

  Fly   538 -------PLNITSECWFQNILEIYKKNKLEPNDISLNGGSHDAWAYPI------VSTIFYDTLSH 589
                   .:|:|.. ||:|:.      .||.:...:...|.|....|:      |:..:.|.|:.
  Fly   416 VIDGVYSDINMTGN-WFENLC------ILEGSRARIRLRSVDKALIPLLMPTRTVNAYYADFLNL 473

  Fly   590 SIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSI---------------------TKSFD 633
            :.:. :.:...|:::...|..|.||.||..|..|:....                     .::|.
  Fly   474 AFIT-IGMAQWPFYHIDFPDVLKYAGVGNIIGHEMAHGFDSYCYQYNYDGKKTNWWSSASLRNFK 537

  Fly   634 EKAMRCVPHSVNIF--------SNYSRMDILIHSGGMQISYHSMLSLTGPIKGMAR-LPGLNLTP 689
            |: .||:....|.|        .:.:..|.:..:.|.:::|::....||....:.: |.|:|...
  Fly   538 ER-YRCLESQYNKFILMGVQTNGSLTSGDNIADNVGTRMAYYAFKRKTGDKAWLEKPLRGVNFNN 601

  Fly   690 TQIFFLVSAQELC-------------------AESNYLGIDTNAPEFDNILGWLVAQGGSATEVF 735
            .|:||:..||..|                   .|....|..:|.|||              :|.|
  Fly   602 KQLFFVKFAQTWCNGKDNGDKLRRLKTDVHAYDEFRVQGTLSNMPEF--------------SEAF 652

  Fly   736 KCPSGSMINVQKTCNV 751
            .|..|:.:|..|.|.|
  Fly   653 NCKLGTEMNPLKKCVV 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 142/700 (20%)
Nepl7NP_001285879.1 PepO 43..669 CDD:226118 145/714 (20%)
M13 52..666 CDD:189000 142/701 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.