DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl6

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609023.3 Gene:Nepl6 FlyBaseID:FBgn0259716 Length:655 Species:Drosophila melanogaster

Alignment Length:728 Identity:136/729 (19%)
Similarity:254/729 (35%) Gaps:213/729 (29%)


  Fly   153 PECSDPICEAVASSIQARLNWN--------KDPCTEFKKFSC------WRNTPNKNITNLIEM-- 201
            |.|:.|..:.|.:...:||..|        ...|..:.:::|      .|:.|   .|.:|:|  
  Fly    11 PICAAPTTQNVEADPNSRLMNNILSYVAEDSSACGTYFQYACGKYAVRHRDDP---FTEIIQMLD 72

  Fly   202 ----GNSQKSVDSQMLYLFQNKIMNGSFG-------ILHNLFESCLQQTTNSTVM-HRIFDSLGG 254
                ||.     .|:::....:..:..|.       :|| .:.:|.:...::..| |.:..:..|
  Fly    73 HKVNGNL-----VQLMHELHQRSQSPGFNESSVEAKVLH-FYRTCREAPPSTRKMEHYLRLAPPG 131

  Fly   255 -------YLPVGSVGPSS---------------IAPLIAKIYDLGPSPLVDLYH-DLSY----GR 292
                   ::|.|...|.:               ...::..:..|..|...:.:. |:|.    |.
  Fly   132 QALTWPQFMPRGEPWPKAQFKWMKSLGHLYRYGFTNVLVNVLVLRSSENSNRFRLDISMPSLEGD 196

  Fly   293 RPHI---------LLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLIENFLPYFVSY 348
            ..|:         |.||..|:.|...|.||||         |:...: ::|.::.::        
  Fly   197 AQHLGGFLSTLATLQIIGVPTKSILPLVRKIR---------RLESAI-RVLTEVDDD-------- 243

  Fly   349 AQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVR 413
              ..||..|:.::     :.:..::.:||.:|.|.::||.    :.|:.              .:
  Fly   244 --DESETWTLRQW-----EYKTGYAWQGFVESIVGHSVSH----HYVMQ--------------AQ 283

  Fly   414 NSDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPE-VCTRSTMWALPELSSSLYIAQH- 476
            |:.|...|:..:......|..|.::....|.::.....|.| :...:.|.....|:|:|...:. 
  Fly   284 NAKYFTGLKRLMDSTDAEVVANYIMTRFVLYLIDDFIDSNEHIDCVTDMRRNMNLASNLLYKERF 348

  Fly   477 -SSEDLKDTTKRAEIIFKSLKAHLKRAPSLKGAALV----KLSALKIQ----------------- 519
             ....|:..|:....:|:.|:.......:.....|.    .:.|.|.|                 
  Fly   349 LDPATLQQYTQEVTKVFEQLRRQFLLQINENRLGLTSEQNSMVATKAQHVVLNIGNLPRGRDHRS 413

  Fly   520 --SQTWEGFSNTTDLLKSLQPLNITSECWFQNILEI-YKKNKLEPNDISLNGGSHDAWAY----- 576
              |:.:|      ||:..|...:...|  ..|:||. .:|..|:.|.   :..:.|.:.|     
  Fly   414 FVSRHYE------DLVFPLPDFDYARE--HLNLLEFRTRKQVLQLNQ---SAPTPDEFFYLSDPK 467

  Fly   577 -PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSITK---SFDE--- 634
             .:.|..:|....:.||||..::..|:|.|.......|:.:|..:|.|::.|:..   .:|.   
  Fly   468 TAMSSGPYYLMRLNIIVVPHGLLQEPFFAADSHDIFKYSLLGFVLAHELMHSVDTVGLYYDRYGN 532

  Fly   635 ---------------KAMRCVPHSVNIFSNYSRMDILIHSGGMQISY------HSMLSLTGPIKG 678
                           ..::|:..:...:.:....||    .|:.::|      .|.:|||    .
  Fly   533 IHEIGPQISSSPRFVAGLQCLNRNSTQYLDERIADI----AGLDLAYSTYFQNSSQMSLT----D 589

  Fly   679 MARLPGLNLTPTQIFFLVSAQELCAES---NYLGIDTNAPEFDNILGWLVAQGGSAT--EVFKCP 738
            ...:|     |.|||||..||..|.:.   |::|.|.:......:|      .|.|.  |.|.||
  Fly   590 FTTIP-----PQQIFFLNLAQFFCGDGDPINFVGHDNDETRLQQML------NGFAPFHEAFGCP 643

  Fly   739 SGSMINVQKTCNV 751
            :.|  |..:.|.:
  Fly   644 AKS--NQPEKCQL 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 128/694 (18%)
Nepl6NP_609023.3 M13 42..653 CDD:189000 129/695 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.