DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl5

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609022.1 Gene:Nepl5 FlyBaseID:FBgn0031808 Length:684 Species:Drosophila melanogaster

Alignment Length:704 Identity:127/705 (18%)
Similarity:244/705 (35%) Gaps:225/705 (32%)


  Fly   144 RCSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSV 208
            |.:|...........:.|.:|..:|:.::....||..|.:::|               ||.|...
  Fly    17 RTTPTACRQTNAPQSVQEMLAEQLQSYMDTKARPCENFYQYAC---------------GNWQIQQ 66

  Fly   209 DSQMLYLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKI 273
            ..|                 |:|.:   :..|.....::     |..||..::|           
  Fly    67 QEQ-----------------HSLRD---RDWTRDRQRYQ-----GQMLPTDTLG----------- 95

  Fly   274 YDLGPSPLVDLYHDLSYGRRPHILLIISGPS---TSSTILE------RKIRWMSP--------KA 321
                   |:|  |  |..|:..:||.....|   :.|:|||      |..:.:.|        ..
  Fly    96 -------LID--H--SVNRKLELLLRRRNESSFESDSSILEQMRLYYRSCKRLKPYNLKKYLQLL 149

  Fly   322 PPS------------------------RIR-QGVPKLLADLIENFLP-------YFVSYAQRVSE 354
            |||                        |:| .|:..:|  |.|..||       |.: |..:.|.
  Fly   150 PPSNSTQWPSVGRGWRPERFDWITTLGRLRLHGLNGVL--LREEVLPRWDDSRNYSI-YVNKPSR 211

  Fly   355 KDT-------IFEFIKDLNKL---------QVEHSRRGFWDSTVLYNVSSLQD------------ 391
            ::|       :.|.:.|:.:.         ||:...|      .|:.:..|:|            
  Fly   212 QETQPMGEGAMIELLLDIGQTKRTANALARQVDDFER------KLHRLQELEDDEGPREMQLGYL 270

  Fly   392 --LYPVLNWTLLIPQ-------NWSGPIVVRNSDYLKALEYFL-TKYPTRVAHNSLLLLSALQIL 446
              ..|.|.|...:.|       :....:::.|..||:||...: ::.|..|.  |.::|..|..|
  Fly   271 DSYLPQLRWLSFMRQVRIDSELDLRSTLIIENIPYLRALSDLMESESPDTVC--SYIMLKWLAFL 333

  Fly   447 PRDYP---SPEVCTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEIIFKSLKA---------HL 499
            .:..|   |...|..:...|:| |:||..:.|..|:  .::......:|:.||.         .:
  Fly   334 KQQGPADISRGECVAALRRAMP-LASSWLVGQQFSD--PESESYVSSLFQRLKVRFGQILAENRM 395

  Fly   500 KRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQ---PLNITSECWFQNILEIYKKNKLEP 561
            :.:|.|......||.|:::|.    ||..|.::....|   .::::...::.|.| :..:.::|.
  Fly   396 RLSPPLVHILQQKLRAVRLQM----GFFQTEEIEDVEQYHVRIDLSGHSFYGNQL-VLLRQRVEA 455

  Fly   562 N---------DISLNGGSH-----DAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLH 612
            |         :.:.:.||:     ::|.....|.: |....:.::||..::.:|.::..:.....
  Fly   456 NHDLLYINVTNFANSTGSNLSYLSESWEASNSSPL-YVRPRNLVLVPHGLLQLPIWHRNISALQQ 519

  Fly   613 YASVGVSIAKEILRSI----------------------TKSFDEKAMRCVPHSVNIFSNYSRMDI 655
            :|.:|..:|.|:....                      ::.| .:.::|:...:...|.:.. :.
  Fly   520 HAVMGFVLAHELAHGFDMLGMDYDAMGNIMGPVEEIGASRQF-RQGLQCLQQQMATGSKWID-EK 582

  Fly   656 LIHSGGMQISYHSMLSLTGPIKGMARLPGL-NLTPTQIFFLVSAQELCAESNYL 708
            |.....::::|.:...:..  |...|.|.| ..:..|:||:..||..|..:..|
  Fly   583 LADFVALRLAYETFFGVRD--KREPRDPLLPQFSQRQLFFITFAQFFCGRTPVL 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 122/673 (18%)
Nepl5NP_609022.1 PepO 42..684 CDD:226118 122/680 (18%)
GluZincin 48..682 CDD:301352 122/674 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.