DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl4

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609019.1 Gene:Nepl4 FlyBaseID:FBgn0031805 Length:652 Species:Drosophila melanogaster

Alignment Length:714 Identity:146/715 (20%)
Similarity:262/715 (37%) Gaps:203/715 (28%)


  Fly   147 PAVSAP--PECSDPICEAVASSIQARLNWNKDPCTEFKKFSC--WRNTPNKNIT-NLIEMGNSQK 206
            |..|.|  .||:..|.:....::.:.::..|:||.:|..::|  ||.....:.| .:|    |:.
  Fly    28 PEQSCPYLGECNSTINQQHIDTLMSYVDSEKNPCEDFYAYACGKWRAKHGSHTTATMI----SES 88

  Fly   207 SVDSQMLYLFQNKIMNGS---FG-------ILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSV 261
            .::.|...||...:.|.|   :|       :.|  ::||:  ......:.|..:.|...| :.|:
  Fly    89 QINRQYEDLFLQLLRNPSAPEYGYPMFAKVLAH--YQSCI--ALEKPDLRRYIELLDRDL-LASL 148

  Fly   262 GPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPK------ 320
            ..:....|:|.   ||           .||...|.:.:             ::||.:..      
  Fly   149 NSTHWMHLLAA---LG-----------RYGYHGHYVQV-------------EVRWYNATHHMIFL 186

  Fly   321 APPSR-----IRQGVPKLLADLIENFLPYFVSYAQRVSEKDTIFEFIKDLNKLQVEHSRRGFWDS 380
            .|.:|     :.|.:...|:....::.|     ..::.|:....|  ::|.:|...||.    |.
  Fly   187 LPHNRHLNLSLTQDIYDALSQDGSSWPP-----LHQLQEQFRSLE--QNLVRLAKPHSA----DD 240

  Fly   381 TVL-YNVSSLQDLYPVLNW-----TLL---IPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNS 436
            |.. |::..::...|.|:|     |.|   :|.|.     |...|.|.|:| .|.:|...|  ::
  Fly   241 TFRNYSLDQIRTEVPGLHWDEALRTQLGRSVPGNH-----VFQVDDLDAIE-GLVEYLNTV--DT 297

  Fly   437 LLL--------LSALQILPRDYPSPEVCTRSTMW----------ALPELSSSLYIAQHSSEDLKD 483
            |||        ||.|..||.:    .:.|    |          .:..:..|:|:..:...:...
  Fly   298 LLLNRYSLARFLSHLLELPHN----PLAT----WESGQRSRGRNCIRHMRRSVYLPMNYVYERSF 354

  Fly   484 TTKRAEI-------IFKSLKAHLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQ---- 537
            .::|...       :|:.|::.|:               |::|.   ..|:.:.||:||||    
  Fly   355 YSRRRHADELVIHSVFQQLQSQLE---------------LRVQH---NAFNLSQDLVKSLQAKVH 401

  Fly   538 ---------PLNITSECW-------------FQNILE--IYKKNKLEPNDISLNGGSHDAW---- 574
                     |.|:|.:.:             ::|.|.  :|....:...:.|.:....|.|    
  Fly   402 QMRINVGNLPPNVTEQFYWDSDRRWSVGRDFYENHLNSLLYYYTLVADLESSSDQEERDIWYSFN 466

  Fly   575 ----AYP--IVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRSI-TKSF 632
                .:|  |.:|.::..|.:.|.||.|.:..|:|:|...|.|.|..:..::..||:.:. |...
  Fly   467 MHTPEFPDNIDATPYFYCLGNIIFVPYSYVKRPFFDANFWPALLYGDLANTLGHEIMHAFDTDLV 531

  Fly   633 DEKAMRCVPHSVNIFSNYSRM--DILIHSGGMQISYHSMLSL---TGPIKG----MARLPGLNLT 688
            |..|.       ....|:|..  ::.:::|.:.....|.:.|   |..:.|    |....|..||
  Fly   532 DYDAQ-------GNLRNFSDQLGEVELYNGAVGCLNSSAVMLNERTSDVSGSRLAMQTYGGDWLT 589

  Fly   689 PT---QIFFLVSAQELCAESNYLGIDTNAPEFDNILGWLVAQGGSATEVFKCPSGSMINVQKTC 749
            .:   :::||..|...|.:......|:.:...:..||    |.....|||:|..||.:.....|
  Fly   590 RSGNGRLYFLQFAHFFCGDEGDQYHDSGSQRLNYALG----QVPQFAEVFRCHVGSGMTSADQC 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 138/682 (20%)
Nepl4NP_609019.1 PepO 51..643 CDD:226118 139/684 (20%)
GluZincin 59..649 CDD:301352 138/682 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.