DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nep3

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001245775.1 Gene:Nep3 FlyBaseID:FBgn0031081 Length:786 Species:Drosophila melanogaster

Alignment Length:811 Identity:171/812 (21%)
Similarity:293/812 (36%) Gaps:232/812 (29%)


  Fly    95 WLRTSAAVHKMAITSATLLVTTLLVASPILFLISTAP---------SPLPRDCYMDGDRCSPAVS 150
            ||..:..|  ||||..|||:        :||....:.         .|..:||        |:.:
  Fly    53 WLLITTFV--MAITIFTLLI--------VLFTDGGSSDATKHVLHVQPHQKDC--------PSGN 99

  Fly   151 APPECSDPICEAVASSIQARLNWNKDPCTEFKKFSC--W-RNTPNKNITNLIEMGNSQKSVDSQM 212
            ..| |.:..|...:|.|...::...|||.:|..:||  | :|.|                     
  Fly   100 ELP-CLNKHCIFASSEILKSIDVTVDPCDDFYGYSCNQWIKNNP--------------------- 142

  Fly   213 LYLFQNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIAKIY--- 274
              :.:.|...|:||.|..:         |..::..:.:.     |..|.  .|.|...||:|   
  Fly   143 --IPEGKSTWGTFGKLEQM---------NQLIIRNVLEK-----PAKSF--KSDAERKAKVYYES 189

  Fly   275 ---------DLGPSPLVDLYHDLSYGRRPHILLIISGPSTSST--------------ILERKIR- 315
                     .||..|:.||            ||.|.|.:.:.:              ||..|.. 
  Fly   190 CLDADEHMEKLGAKPMNDL------------LLQIGGWNVTKSGYNVANWTMGHTLKILHNKYNF 242

  Fly   316 -----WMSPKAPPSRIRQ-------GVPKLLADLIEN-------FLPYFVSYAQRV------SEK 355
                 |...:...:..|.       |:....||...|       .|..::.|..:|      :|.
  Fly   243 NCLFGWAIGEDDKNSSRHVIQIDQGGLTLPTADYYNNKTDNHRKVLNEYIEYMTKVCVLLGANES 307

  Fly   356 DT------IFEFIKDLNKLQVE-HSRRGFWDSTVLYN---VSSLQDLYPVLNWT-------LLIP 403
            |.      :..|.|.|..:.:. ..||   :...:|:   :..|..|.|.||||       .::.
  Fly   308 DARAQMIGVINFEKKLANITIPLEDRR---NEEAMYHPMQLRQLSKLAPFLNWTDHFDNAMQMVG 369

  Fly   404 QNWSGP--IVVRNSDYLKALEYFLTKYPT----RVAHNSLLLLSALQILPRDYPSP-EVCTRSTM 461
            :..:..  :||...|:||.|...:.|...    ::..|:.|:..|::.|......| ....:...
  Fly   370 RRVTDDEVVVVYAPDFLKNLSDIILKMEQTEEGKITLNNYLVWQAVRTLTSCLSKPFRDAYKGVR 434

  Fly   462 WALPELSSSLYIAQHSSEDLKDTTKRA-EIIFKSLKAHLKRAPSLKG--AALVKLSALKIQSQTW 523
            .||........|.::...|..:....| ..||.....|.:..|:.:.  |.:.:...:.:|:.||
  Fly   435 KALMGSDGGEEIWRYCVSDTNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMNLQNLTW 499

  Fly   524 ----------EGFSNTTDLL-------------KSLQPLNITSECWFQNILE--IYK-KNKLEPN 562
                      |..:..:|::             |....||||...:|:|.::  ||. |:.|:..
  Fly   500 VDKQTREKAIEKANQISDMIGFPDYILDPVELDKKYAELNITPNAYFENNIQVAIYNLKSNLKRL 564

  Fly   563 DISLNGGSHDAWAY-PIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILR 626
            |..:|..:   |.. |.....:|....:.||.|..::..|:|:...|..|::.::||.:..|:..
  Fly   565 DQPVNKTN---WGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVVMGHELTH 626

  Fly   627 SI------------------TKS---FDEKAMRCVPHSVNIFSNYSRM--------DILIHSGGM 662
            :.                  :||   |:||: .|:....:.:....|.        :.:..:||:
  Fly   627 AFDDQGREYDKFGNINRWWDSKSIERFNEKS-ECIARQYSGYKMNGRTLNGKQTLGENIADNGGL 690

  Fly   663 QISYHS-MLSLTGPIKGMARLPGLNLTPTQIFFLVSAQELCA----ESNYLGI--DTNAPEFDNI 720
            :.:||: ..:.:.....:.:|||||||.:|:||:..||..|:    |:|.|.:  |.::|....:
  Fly   691 KAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQMEKDPHSPSQFRV 755

  Fly   721 LGWLVAQGGSATEVFKCPSGSMINVQKTCNV 751
            :|.| :......|||:|..|..:|..:.|.|
  Fly   756 IGTL-SNMKEFAEVFQCKPGKRMNPTEKCEV 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 148/718 (21%)
Nep3NP_001245775.1 M13 123..784 CDD:189000 149/720 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.