DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and goe

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001285350.1 Gene:goe FlyBaseID:FBgn0027528 Length:879 Species:Drosophila melanogaster

Alignment Length:778 Identity:145/779 (19%)
Similarity:265/779 (34%) Gaps:244/779 (31%)


  Fly   107 ITSATLLVTTLLVASPILFLISTAPSPLPRDCYMDGDRCSPAVSAPPECSDPICEAVASSIQARL 171
            :|:|.|....||:   |:.|::..|.             .|.....|.|.|..|  |.||.|..|
  Fly   131 VTTACLCALLLLI---IILLLAFWPE-------------VPFYLRAPLCLDKEC--VESSRQLLL 177

  Fly   172 --NWNKDPCTEFKKFSC-------------------WRNTPNKNITNLIEMG-------NSQK-S 207
              |.:|.||.|..:::|                   |..........|.|:.       |||: |
  Fly   178 WANTSKSPCHETYEWACGNFASDYANHEYFVIKRGEWNYETYNEYQELNELNRFIAMLPNSQEGS 242

  Fly   208 VDSQMLYLFQNKIMNGSFGILHNLFESC-----LQQTTNSTVMHRIFDSLGGYLP------VGSV 261
            |:|                .:.:|:.||     |.::.:..::.|..:::.|:..      :.|.
  Fly   243 VES----------------TVSSLYRSCRETDVLDKSQSDLLLKRAINAVYGWQAFRDSNRLQSW 291

  Fly   262 GPSSIAPLIAKIYDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKI----RWMSPKAP 322
            ....:..::...:.:.|...|.:.:..|   .||..:|        |:.|.::    ::......
  Fly   292 EYKRVLVVLQAKHGIFPYYRVTVENGFS---NPHDYVI--------TLDEGELGLPDKYFYGNDA 345

  Fly   323 PSRIRQGVPKLLADLIEN----------FLPYFVSYAQRVSE--KDTIFEFIKDLNK------LQ 369
            ...:.:|...||.|...|          |......|.:|:..  :|...:..:.:||      |:
  Fly   346 DEEVVRGYKLLLRDFAINMGIVSREADLFADDIFHYERRIVNHIEDAKADANRPINKLMRLADLK 410

  Fly   370 VEHSRRGFWDSTVLYNVSSLQDLYPVLNWTLLIPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAH 434
            ::        :..|..:.|||.::|....|      ....::||:.:.:.||...|:....:..:
  Fly   411 IK--------APSLPILESLQAIFPKTKIT------EDTEVLVRDPEVMHALSVLLSTSDKKPIN 461

  Fly   435 NSLLLLSALQILPR---------------------DYPSPEVCTRSTMWALPELSSSLYIAQHSS 478
            |.::...|.::||.                     .||...:|::.....||....:|. .|...
  Fly   462 NFIVWSLARKMLPHLSKEYRTLAETFDHALYGRTASYPRWLICSKVVRDWLPFAVDALQ-QQPPR 525

  Fly   479 EDLKDTTKRA-------------EIIFKSLKAHLKRA--------PSLKGAALVKLSALKIQ--- 519
            :..:..|.::             :::|.||:..||.:        |:.:.....||:.:::|   
  Fly   526 QQFETMTSKSRGLNKTQGNEELLKLMFFSLRNQLKDSLEQAKWLEPAARQFIQKKLNEMRLQFGI 590

  Fly   520 ---------------------------SQTWEGFSNTTDLLKSLQPLN----ITSECWF----QN 549
                                       ...|......:.:.|.|.||.    |.||.:.    |.
  Fly   591 PDEVLQQPTYLAQYYNELILNNVFFVEHLEWIWTFRRSQMEKKLGPLAILDVIVSEMYTRDNPQA 655

  Fly   550 ILEIYKKNKLEPNDISLNGGSHDAWAYPIV---STIFYDTLSHSIVVPLSVILIPYFN------A 605
            |....|.|.|..:.:.::...:| :.||:.   :.|..|.| .:::...|..|: .||      :
  Fly   656 IAYSNKLNMLLVSKVLISSNYYD-YRYPVAVNFARIGTDIL-EALIDNFSTFLL-QFNTQSTDIS 717

  Fly   606 VLPPYLHYASVGVS----------------IAKEILRS--ITKSFDEKAMRCVPHSVNIFSNYSR 652
            ...|.:.||...|:                ::...|:|  :|.|....|.|.:.:.||.....|.
  Fly   718 DAAPEIRYAQPDVNCLAAGQPPRLVHELNELSSNALKSFHVTLSAARTAARALSNFVNAIDAGSA 782

  Fly   653 MDILIHSGGMQISYHSMLSLTGPIKGMARLPGL-NLTPTQIFFLVSAQELC----AESNYLGI 710
            :.   .||..|.:.:..|.||..:    |:||| :....::|.|...|:.|    |:.:|..|
  Fly   783 IQ---GSGIDQANTYEALGLTRRL----RIPGLRSFNENELFTLSYMQQHCSTTIADKDYARI 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 125/708 (18%)
goeNP_001285350.1 GluZincin 184..>694 CDD:301352 90/553 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.