DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl16 and Nepl3

Sequence 1:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_608904.1 Gene:Nepl3 FlyBaseID:FBgn0031678 Length:629 Species:Drosophila melanogaster

Alignment Length:739 Identity:139/740 (19%)
Similarity:241/740 (33%) Gaps:263/740 (36%)


  Fly   145 CSPAVSAPPECSDPICEAVASSIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQKSVD 209
            ||...||.|...  |.:.:...:..::    :||..|      .|:..||:     ..::..:|.
  Fly    18 CSTVCSANPNLE--IMKRMLDDMDEKV----EPCHNF------YNSSQKNL-----KWHAFATVS 65

  Fly   210 SQMLYLF---QNKIMNGSFGILHNLFESCLQQTTNSTVMHRIFDSLGGYLPVGSVGPSSIAPLIA 271
            .|...||   :|::..      .:.||..||:      :::|..::.             .|.:.
  Fly    66 DQFQLLFDGIENEVFE------KHSFEEKLQR------LYKICSTME-------------RPSLL 105

  Fly   272 KIYDLGPSPLVDLYHDLSY-------GRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQ- 328
            :.::     ||....||::       |:.|                :.|.:||...|   |:|: 
  Fly   106 RYFE-----LVKPGEDLNWPFLTPRGGKWP----------------KEKFQWMEALA---RLRRY 146

  Fly   329 GVPKLLADLIENFLPYFVSYAQR----------VSEK--DTIFEFIKDL---------------- 365
            |.         |.:.:.:|..|.          |.||  |::|.||:.|                
  Fly   147 GF---------NDIMFGMSIRQDPNSDSGQPIVVFEKKYDSLFRFIESLQNIGLPPKLAKEIAPL 202

  Fly   366 ---------NKLQVEHSRRGFWDSTVLYNVSSLQ-DLYPVLNWTLLIPQNWSGP------IVVRN 414
                     :.::.||..|   |:..:..:|..| ::|.| :.|..:...:..|      :.|.|
  Fly   203 DNAIQEMYKSDMKFEHYAR---DAAPVKRISLGQLEIYGV-SLTKYLEIVFGRPFSPDFVVHVEN 263

  Fly   415 SDYLKALEYFLTKYPTRVAHNSLLLLSALQILPRDYPSPEVCTRSTMWALPELSSSLYIAQH--S 477
            ..||:.|:..:|..|::|..|.|....:..|:.......:.|. :||....|.:|:|...:.  .
  Fly   264 LYYLRGLQNLMTAVPSQVVANYLTARFSFYIMFTFMKHGDSCV-TTMRQSMEFASNLLFEERILG 327

  Fly   478 SEDLKDTTKRAEIIFKSLKAH---------LKRAPSLKGAALVKLSALKIQSQTWEG-------- 525
            .:.|:....:|..||.:::..         ||..|:.......||:.|.:......|        
  Fly   328 RKKLRSYQNQAGKIFDAIRQQLNIRLERNVLKLPPAEISLLQKKLNGLSLSIGNLPGKAGHRRFV 392

  Fly   526 --------FSNTTDL----LKSLQ-----PLNITSECWFQN---------ILEIYKKNKLEPNDI 564
                    |::..:|    ||.|:     .|::..:..|::         |...:.:...|.|  
  Fly   393 TRYYKELEFADDEELATAHLKVLEHRTRAELSLLDQPNFKDRRYMLHSYPISNFFFETAYEEN-- 455

  Fly   565 SLNGGSHDAWAYPIVSTIFYDTLSHSI--VVPLSVILIPYFNAVLPPYLHYASVGVSIAKEILRS 627
                |:....||..::...:|..||.|  |.||                     |:....|:|  
  Fly   456 ----GNTIYVAYDFLADASFDPDSHDIFKVTPL---------------------GIRFGLEML-- 493

  Fly   628 ITKSFDEKAMRCVPHSVNIFSNYSRMDILIHSGG--------------MQISYHSMLSLTGPI-- 676
              ||||  ...|..|.||:...:.  |..|.:.|              .:..|..:|.|....  
  Fly   494 --KSFD--LFNCKHHKVNMLQLFD--DNQITTAGDECVSAWTQDNLLSQRDQYLVVLHLVHEAYF 552

  Fly   677 ----KGMARLPGL-NLTPTQIFFLVSAQELCAESNYLGIDTNAPEFDNILGWLVAQGGSA----- 731
                |...|.|.. .::..::||....|....::.|.|.|             ..:|||.     
  Fly   553 AEGSKFSQRQPNFTTMSLRELFFFRFGQSSFGQTLYFGSD-------------FVEGGSPINSLT 604

  Fly   732 -----TEVFKC--PSGSMINVQKT 748
                 ...|.|  |...:...||:
  Fly   605 RLPVFVRTFNCLAPGEQLTTTQKS 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 133/709 (19%)
Nepl3NP_608904.1 GluZincin 42..581 CDD:301352 122/652 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.